Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X452

Protein Details
Accession A0A4T0X452    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-30KSLLKVQQKINKKKSPVHPKGRKAQLLAHydrophilic
NLS Segment(s)
PositionSequence
11-43KINKKKSPVHPKGRKAQLLARASLREERVNKKK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MAKSLLKVQQKINKKKSPVHPKGRKAQLLARASLREERVNKKKLIHTMKKTEENQIVDFIQEYINSEEALKREIFDVDDMQALIETFINRDMDELEQLRASRRPGRPSSKRQDLLEFRIKQEQHVYETGWKVPDLRDPVNVTKLRLWQGGHGGLTSIKFVLVKKEGNIDDSVSSNDLEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.82
4 0.85
5 0.85
6 0.85
7 0.85
8 0.86
9 0.89
10 0.89
11 0.83
12 0.77
13 0.73
14 0.71
15 0.65
16 0.59
17 0.53
18 0.45
19 0.42
20 0.42
21 0.38
22 0.35
23 0.37
24 0.43
25 0.49
26 0.53
27 0.54
28 0.55
29 0.58
30 0.61
31 0.66
32 0.67
33 0.66
34 0.7
35 0.74
36 0.76
37 0.72
38 0.7
39 0.64
40 0.57
41 0.5
42 0.42
43 0.35
44 0.26
45 0.25
46 0.18
47 0.12
48 0.09
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.12
57 0.1
58 0.09
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.08
65 0.09
66 0.08
67 0.07
68 0.07
69 0.06
70 0.05
71 0.05
72 0.04
73 0.04
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.08
81 0.09
82 0.08
83 0.09
84 0.09
85 0.11
86 0.12
87 0.14
88 0.21
89 0.24
90 0.31
91 0.37
92 0.47
93 0.55
94 0.63
95 0.69
96 0.71
97 0.71
98 0.66
99 0.67
100 0.62
101 0.61
102 0.6
103 0.53
104 0.45
105 0.48
106 0.46
107 0.39
108 0.4
109 0.35
110 0.29
111 0.29
112 0.29
113 0.27
114 0.28
115 0.29
116 0.23
117 0.21
118 0.19
119 0.18
120 0.23
121 0.23
122 0.23
123 0.26
124 0.3
125 0.33
126 0.4
127 0.41
128 0.37
129 0.35
130 0.39
131 0.38
132 0.36
133 0.34
134 0.29
135 0.33
136 0.33
137 0.3
138 0.25
139 0.22
140 0.19
141 0.19
142 0.17
143 0.11
144 0.09
145 0.1
146 0.11
147 0.17
148 0.2
149 0.22
150 0.23
151 0.31
152 0.31
153 0.33
154 0.34
155 0.29
156 0.26
157 0.25
158 0.25
159 0.18
160 0.17