Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0X242

Protein Details
Accession A0A4T0X242   
Localization Confidence High
Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-59NETQEEKKKKKESRKEAHKLALIBasic
87-121IMKNKGLTARRKKENRNARVKKRNKYDTAKKKLKSBasic
NLS Segment(s)
PositionSequence
43-55KKKKKESRKEAHK
91-121KGLTARRKKENRNARVKKRNKYDTAKKKLKS
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
IPR018972  Sas10_C_dom  
Pfam View protein in Pfam  
PF09368  Sas10  
Amino Acid Sequences MATFVYNKPAEGHRADKAVKPVLKVKHDVKELEKFFNETQEEKKKKKESRKEAHKLALIAAREGKLQEMQEEESIGETGKRAIGYQIMKNKGLTARRKKENRNARVKKRNKYDTAKKKLKSIRAVYEGQKGPYMGELTGISKKISRSVKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.42
5 0.45
6 0.43
7 0.42
8 0.45
9 0.47
10 0.5
11 0.52
12 0.52
13 0.52
14 0.54
15 0.54
16 0.52
17 0.54
18 0.52
19 0.5
20 0.45
21 0.41
22 0.37
23 0.39
24 0.36
25 0.29
26 0.34
27 0.4
28 0.46
29 0.45
30 0.54
31 0.57
32 0.64
33 0.72
34 0.75
35 0.76
36 0.8
37 0.87
38 0.87
39 0.85
40 0.82
41 0.74
42 0.63
43 0.54
44 0.47
45 0.36
46 0.28
47 0.22
48 0.17
49 0.14
50 0.14
51 0.12
52 0.1
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.08
62 0.07
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.1
71 0.12
72 0.17
73 0.24
74 0.26
75 0.26
76 0.26
77 0.28
78 0.28
79 0.33
80 0.38
81 0.42
82 0.48
83 0.57
84 0.66
85 0.72
86 0.78
87 0.81
88 0.81
89 0.82
90 0.84
91 0.85
92 0.88
93 0.89
94 0.88
95 0.88
96 0.87
97 0.85
98 0.85
99 0.85
100 0.85
101 0.87
102 0.87
103 0.78
104 0.78
105 0.76
106 0.75
107 0.74
108 0.7
109 0.68
110 0.64
111 0.67
112 0.62
113 0.63
114 0.57
115 0.49
116 0.43
117 0.35
118 0.3
119 0.28
120 0.25
121 0.16
122 0.15
123 0.15
124 0.16
125 0.2
126 0.21
127 0.18
128 0.2
129 0.21
130 0.27
131 0.33