Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DQX6

Protein Details
Accession A5DQX6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-45LGYAYRCWRRQWKGEGQRYSGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, nucl 9, cyto_mito 9, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036156  Beta-gal/glucu_dom_sf  
IPR017853  Glycoside_hydrolase_SF  
IPR013783  Ig-like_fold  
IPR041447  Mannosidase_ig  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
KEGG pgu:PGUG_05677  -  
Pfam View protein in Pfam  
PF17786  Mannosidase_ig  
Amino Acid Sequences MYTHRLLPTHPAWIYATQLMQSECLGYAYRCWRRQWKGEGQRYSGGAIVWQINDCWPVASWALVDYYRRPKLAFYSVKRESRTVGVGMYRTEEKHTPEQAKAVSEAGPPHDYSKADLYVDIWGVNSSVVDIPAILKVDIYNVTSGEKVDSLDDRAIVLKQNQTTELVSRHFLKYDFPVVVYSRFVSEDGSVIGSAADWPQPLKYLKFNDREISFRVEENKIVLSANKPVKGVEVVLKNDLFLEDNGFDIFPGDEKVVGVQGIREEDVESVRYYGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.26
4 0.2
5 0.22
6 0.2
7 0.18
8 0.17
9 0.14
10 0.12
11 0.13
12 0.13
13 0.1
14 0.16
15 0.25
16 0.34
17 0.38
18 0.45
19 0.54
20 0.6
21 0.69
22 0.72
23 0.73
24 0.75
25 0.8
26 0.8
27 0.75
28 0.71
29 0.63
30 0.55
31 0.45
32 0.33
33 0.24
34 0.19
35 0.17
36 0.13
37 0.12
38 0.12
39 0.12
40 0.13
41 0.12
42 0.1
43 0.09
44 0.1
45 0.1
46 0.1
47 0.09
48 0.09
49 0.1
50 0.11
51 0.12
52 0.15
53 0.24
54 0.27
55 0.27
56 0.27
57 0.27
58 0.31
59 0.4
60 0.43
61 0.4
62 0.47
63 0.54
64 0.59
65 0.59
66 0.55
67 0.47
68 0.41
69 0.38
70 0.29
71 0.23
72 0.2
73 0.19
74 0.18
75 0.18
76 0.17
77 0.15
78 0.17
79 0.18
80 0.21
81 0.26
82 0.32
83 0.32
84 0.31
85 0.34
86 0.32
87 0.31
88 0.27
89 0.22
90 0.17
91 0.15
92 0.15
93 0.15
94 0.15
95 0.14
96 0.15
97 0.16
98 0.15
99 0.15
100 0.17
101 0.15
102 0.14
103 0.14
104 0.13
105 0.12
106 0.12
107 0.1
108 0.07
109 0.06
110 0.06
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.05
122 0.05
123 0.04
124 0.06
125 0.06
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.07
136 0.07
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.09
143 0.09
144 0.11
145 0.12
146 0.14
147 0.14
148 0.15
149 0.16
150 0.16
151 0.17
152 0.17
153 0.15
154 0.16
155 0.18
156 0.18
157 0.17
158 0.17
159 0.17
160 0.17
161 0.19
162 0.18
163 0.15
164 0.17
165 0.17
166 0.18
167 0.17
168 0.14
169 0.12
170 0.12
171 0.12
172 0.11
173 0.1
174 0.09
175 0.09
176 0.09
177 0.08
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.05
185 0.06
186 0.06
187 0.11
188 0.13
189 0.15
190 0.21
191 0.28
192 0.36
193 0.42
194 0.45
195 0.47
196 0.47
197 0.48
198 0.45
199 0.43
200 0.36
201 0.32
202 0.34
203 0.29
204 0.28
205 0.26
206 0.24
207 0.18
208 0.18
209 0.17
210 0.15
211 0.21
212 0.26
213 0.27
214 0.26
215 0.25
216 0.27
217 0.27
218 0.27
219 0.25
220 0.26
221 0.26
222 0.3
223 0.29
224 0.27
225 0.26
226 0.25
227 0.2
228 0.14
229 0.15
230 0.12
231 0.12
232 0.13
233 0.13
234 0.12
235 0.11
236 0.11
237 0.08
238 0.09
239 0.09
240 0.09
241 0.09
242 0.1
243 0.1
244 0.1
245 0.1
246 0.09
247 0.11
248 0.13
249 0.14
250 0.13
251 0.13
252 0.14
253 0.16
254 0.16
255 0.15