Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DLV7

Protein Details
Accession A5DLV7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-90QEDFMKWRRKQINKSNTAKIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pgu:PGUG_04258  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRLAVRTHVARLHSSALAMQSSCKAGTVLNLKVKKSGDEPVALEDSEYPDWLWDCLNKEKMNETLKQEDFMKWRRKQINKSNTAKIKNNNFMSTIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.19
5 0.18
6 0.16
7 0.14
8 0.12
9 0.13
10 0.12
11 0.11
12 0.1
13 0.09
14 0.14
15 0.18
16 0.22
17 0.28
18 0.32
19 0.31
20 0.35
21 0.35
22 0.32
23 0.29
24 0.28
25 0.23
26 0.22
27 0.22
28 0.21
29 0.21
30 0.19
31 0.17
32 0.12
33 0.13
34 0.11
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.07
42 0.11
43 0.15
44 0.21
45 0.21
46 0.22
47 0.24
48 0.3
49 0.32
50 0.33
51 0.33
52 0.36
53 0.35
54 0.36
55 0.36
56 0.33
57 0.36
58 0.4
59 0.45
60 0.42
61 0.51
62 0.59
63 0.66
64 0.73
65 0.77
66 0.8
67 0.8
68 0.83
69 0.83
70 0.83
71 0.81
72 0.79
73 0.77
74 0.76
75 0.75
76 0.74
77 0.66