Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DHB7

Protein Details
Accession A5DHB7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
165-186AVTSRGKKRVDHKKGFMSKIKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
KEGG pgu:PGUG_02668  -  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MPYSTGRGGAGNFHSAGESSKVISPSNSSNDAQNGHPQPQPHSKHDNKHYVSTGRGGAGNITTSEDAPSPKLVPQGSNTPQLHTNKVTTGRGGYGNMVSNDNPELTRKLQDVEHQVSPKENELYTQASNRSFSVGRGGFGNVISHTKSGTSQRSGGSNDPPNLMAVTSRGKKRVDHKKGFMSKIKEIFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.19
4 0.17
5 0.15
6 0.14
7 0.17
8 0.18
9 0.18
10 0.19
11 0.2
12 0.22
13 0.27
14 0.29
15 0.26
16 0.27
17 0.3
18 0.31
19 0.29
20 0.33
21 0.31
22 0.31
23 0.32
24 0.31
25 0.34
26 0.42
27 0.46
28 0.44
29 0.5
30 0.53
31 0.61
32 0.68
33 0.72
34 0.66
35 0.65
36 0.63
37 0.56
38 0.51
39 0.45
40 0.37
41 0.28
42 0.25
43 0.2
44 0.16
45 0.14
46 0.12
47 0.1
48 0.1
49 0.09
50 0.08
51 0.09
52 0.1
53 0.1
54 0.1
55 0.11
56 0.1
57 0.11
58 0.15
59 0.14
60 0.15
61 0.16
62 0.23
63 0.25
64 0.33
65 0.32
66 0.3
67 0.35
68 0.36
69 0.37
70 0.3
71 0.28
72 0.22
73 0.25
74 0.24
75 0.19
76 0.18
77 0.16
78 0.15
79 0.15
80 0.12
81 0.1
82 0.12
83 0.12
84 0.12
85 0.1
86 0.1
87 0.1
88 0.1
89 0.09
90 0.09
91 0.11
92 0.11
93 0.13
94 0.13
95 0.14
96 0.15
97 0.19
98 0.24
99 0.26
100 0.28
101 0.28
102 0.27
103 0.28
104 0.28
105 0.26
106 0.21
107 0.17
108 0.14
109 0.15
110 0.18
111 0.18
112 0.2
113 0.2
114 0.19
115 0.21
116 0.2
117 0.2
118 0.17
119 0.16
120 0.22
121 0.19
122 0.19
123 0.19
124 0.19
125 0.17
126 0.17
127 0.17
128 0.1
129 0.12
130 0.12
131 0.11
132 0.11
133 0.11
134 0.14
135 0.19
136 0.24
137 0.25
138 0.27
139 0.29
140 0.33
141 0.35
142 0.36
143 0.37
144 0.39
145 0.37
146 0.36
147 0.34
148 0.31
149 0.28
150 0.25
151 0.18
152 0.14
153 0.2
154 0.25
155 0.29
156 0.33
157 0.35
158 0.41
159 0.51
160 0.59
161 0.62
162 0.65
163 0.69
164 0.75
165 0.82
166 0.84
167 0.82
168 0.78
169 0.76