Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DB79

Protein Details
Accession A5DB79    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-102PKEEYRLKMVRDRKKRNKGAPKKKTSBasic
NLS Segment(s)
PositionSequence
85-102MVRDRKKRNKGAPKKKTS
Subcellular Location(s) nucl 16.5, mito_nucl 12.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pgu:PGUG_00534  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSILKGLPSKTRLMEVKKLAADIFQNQWNPNRVRNGAKVLRAPLKGPQVASYYGNNDDMPTFKDFKEWFPELQLTDPKEEYRLKMVRDRKKRNKGAPKKKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.5
4 0.46
5 0.46
6 0.39
7 0.34
8 0.3
9 0.25
10 0.24
11 0.22
12 0.24
13 0.25
14 0.29
15 0.34
16 0.34
17 0.35
18 0.38
19 0.37
20 0.39
21 0.41
22 0.45
23 0.42
24 0.44
25 0.41
26 0.4
27 0.42
28 0.38
29 0.35
30 0.31
31 0.32
32 0.3
33 0.27
34 0.25
35 0.21
36 0.22
37 0.23
38 0.19
39 0.16
40 0.16
41 0.17
42 0.14
43 0.13
44 0.11
45 0.1
46 0.12
47 0.13
48 0.13
49 0.12
50 0.18
51 0.18
52 0.21
53 0.27
54 0.27
55 0.25
56 0.26
57 0.28
58 0.24
59 0.27
60 0.29
61 0.24
62 0.25
63 0.26
64 0.23
65 0.26
66 0.27
67 0.25
68 0.29
69 0.31
70 0.32
71 0.39
72 0.49
73 0.55
74 0.64
75 0.73
76 0.75
77 0.82
78 0.89
79 0.91
80 0.93
81 0.94
82 0.95