Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q75CR0

Protein Details
Accession Q75CR0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
97-116VDSRKRRGKGAPTKKKEASTBasic
NLS Segment(s)
PositionSequence
100-123RKRRGKGAPTKKKEASTDTKKKRK
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
KEGG ago:AGOS_ACL141C  -  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAQHHLETRQGYWVQDVMSIPKERLQQVAQISARIFDQCYNPSGARIGTKILTKRLRGPAMVQYYGNPDLLRFRQLKSLYPGFKFTDPEEQYRLQMVDSRKRRGKGAPTKKKEASTDTKKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.18
5 0.22
6 0.22
7 0.21
8 0.23
9 0.27
10 0.26
11 0.29
12 0.27
13 0.27
14 0.28
15 0.35
16 0.31
17 0.29
18 0.28
19 0.25
20 0.24
21 0.2
22 0.18
23 0.12
24 0.14
25 0.14
26 0.15
27 0.18
28 0.17
29 0.17
30 0.18
31 0.16
32 0.14
33 0.13
34 0.13
35 0.12
36 0.16
37 0.17
38 0.24
39 0.27
40 0.28
41 0.34
42 0.38
43 0.38
44 0.35
45 0.35
46 0.35
47 0.35
48 0.34
49 0.28
50 0.21
51 0.24
52 0.24
53 0.22
54 0.15
55 0.11
56 0.13
57 0.14
58 0.19
59 0.16
60 0.16
61 0.23
62 0.24
63 0.28
64 0.3
65 0.37
66 0.36
67 0.36
68 0.39
69 0.35
70 0.36
71 0.34
72 0.3
73 0.33
74 0.31
75 0.33
76 0.33
77 0.32
78 0.31
79 0.31
80 0.29
81 0.19
82 0.22
83 0.25
84 0.31
85 0.37
86 0.45
87 0.5
88 0.51
89 0.55
90 0.58
91 0.63
92 0.64
93 0.68
94 0.71
95 0.72
96 0.8
97 0.81
98 0.8
99 0.74
100 0.71
101 0.7
102 0.7
103 0.73