Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DFJ7

Protein Details
Accession A5DFJ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LFCLKEKNAKKINSHRWCFQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 5, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004835  Chitin_synth  
IPR004834  Chitin_synth_fun  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004100  F:chitin synthase activity  
GO:0071555  P:cell wall organization  
GO:0006031  P:chitin biosynthetic process  
KEGG pgu:PGUG_02048  -  
Pfam View protein in Pfam  
PF01644  Chitin_synth_1  
Amino Acid Sequences MVTDRVYLTSNSTPVQLLFCLKEKNAKKINSHRWCFQSFAPILNPKVIMLLDCGTRPAKDAFYYLWRAFRDPNVAGACGEMKAALGKGRRLLQNPLVAAQNFEYKISNILDKPMESVFGFISVLPGAFSAYRWEALLNVDGKGPLEKYFKGEFLHQDSQIEDDDDEKLLKEKNYQEAGIFTSNMYLAEDRILCFELVAKRNHNYILRYVEEAKAETDVPERIDEFVLQRRRWLNGSLFAAGYAVVHWTKIWRSNHSLLRKLFLQLEFYYQLVTLLVSWFSLASFFLVFRILTANLGAKEMNFGIGKYLSVIFLWLYVGSVVCTFVLAFGNTPRGTKKFYSVIAVLFAIMMLYMLFAAVFLAVHTVTSVLKAHKDDFKPMMLFTNSKFRDLIVSTGSTYALYFIASLLYGAPSFMVTSFGQYLLLSPTYVKVLNIYAFSNIDDVSWGTKGAPEAKNLGTARSTGANKDDIVMVVPGVEEELNESYMQTLESLRTVPPPEATD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.2
4 0.19
5 0.2
6 0.24
7 0.27
8 0.27
9 0.36
10 0.39
11 0.48
12 0.53
13 0.56
14 0.61
15 0.68
16 0.78
17 0.79
18 0.8
19 0.78
20 0.76
21 0.72
22 0.65
23 0.56
24 0.55
25 0.46
26 0.44
27 0.43
28 0.42
29 0.41
30 0.4
31 0.38
32 0.28
33 0.29
34 0.24
35 0.18
36 0.15
37 0.16
38 0.15
39 0.14
40 0.18
41 0.17
42 0.17
43 0.19
44 0.19
45 0.19
46 0.19
47 0.21
48 0.22
49 0.27
50 0.34
51 0.33
52 0.36
53 0.35
54 0.36
55 0.37
56 0.38
57 0.38
58 0.32
59 0.37
60 0.33
61 0.32
62 0.29
63 0.28
64 0.24
65 0.17
66 0.17
67 0.1
68 0.07
69 0.08
70 0.09
71 0.12
72 0.14
73 0.17
74 0.21
75 0.28
76 0.33
77 0.35
78 0.4
79 0.42
80 0.44
81 0.43
82 0.4
83 0.38
84 0.33
85 0.31
86 0.26
87 0.26
88 0.21
89 0.21
90 0.2
91 0.16
92 0.2
93 0.2
94 0.22
95 0.17
96 0.21
97 0.21
98 0.2
99 0.22
100 0.19
101 0.19
102 0.15
103 0.15
104 0.11
105 0.11
106 0.11
107 0.08
108 0.09
109 0.07
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.09
117 0.1
118 0.1
119 0.11
120 0.11
121 0.1
122 0.12
123 0.16
124 0.13
125 0.12
126 0.13
127 0.13
128 0.13
129 0.13
130 0.13
131 0.13
132 0.16
133 0.16
134 0.2
135 0.22
136 0.24
137 0.24
138 0.27
139 0.27
140 0.32
141 0.35
142 0.31
143 0.29
144 0.27
145 0.28
146 0.25
147 0.21
148 0.13
149 0.09
150 0.1
151 0.1
152 0.1
153 0.08
154 0.1
155 0.11
156 0.12
157 0.17
158 0.2
159 0.27
160 0.29
161 0.29
162 0.28
163 0.26
164 0.28
165 0.24
166 0.2
167 0.13
168 0.11
169 0.11
170 0.1
171 0.1
172 0.07
173 0.06
174 0.08
175 0.08
176 0.08
177 0.09
178 0.1
179 0.09
180 0.08
181 0.12
182 0.16
183 0.2
184 0.22
185 0.24
186 0.24
187 0.26
188 0.3
189 0.29
190 0.25
191 0.25
192 0.27
193 0.25
194 0.26
195 0.26
196 0.25
197 0.22
198 0.21
199 0.17
200 0.14
201 0.13
202 0.11
203 0.11
204 0.1
205 0.1
206 0.1
207 0.1
208 0.1
209 0.1
210 0.1
211 0.1
212 0.17
213 0.22
214 0.22
215 0.26
216 0.26
217 0.28
218 0.29
219 0.31
220 0.25
221 0.25
222 0.27
223 0.23
224 0.21
225 0.19
226 0.18
227 0.14
228 0.12
229 0.06
230 0.05
231 0.04
232 0.04
233 0.04
234 0.06
235 0.07
236 0.14
237 0.17
238 0.19
239 0.25
240 0.32
241 0.39
242 0.43
243 0.49
244 0.42
245 0.43
246 0.39
247 0.35
248 0.31
249 0.25
250 0.23
251 0.17
252 0.19
253 0.18
254 0.17
255 0.15
256 0.12
257 0.12
258 0.08
259 0.08
260 0.05
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.05
275 0.05
276 0.07
277 0.07
278 0.07
279 0.07
280 0.09
281 0.08
282 0.09
283 0.09
284 0.07
285 0.08
286 0.08
287 0.09
288 0.08
289 0.07
290 0.08
291 0.08
292 0.08
293 0.08
294 0.09
295 0.07
296 0.06
297 0.07
298 0.05
299 0.05
300 0.06
301 0.05
302 0.04
303 0.04
304 0.04
305 0.04
306 0.05
307 0.05
308 0.04
309 0.04
310 0.04
311 0.05
312 0.06
313 0.05
314 0.06
315 0.07
316 0.12
317 0.12
318 0.14
319 0.16
320 0.17
321 0.21
322 0.22
323 0.26
324 0.25
325 0.26
326 0.3
327 0.28
328 0.26
329 0.23
330 0.22
331 0.17
332 0.12
333 0.11
334 0.06
335 0.05
336 0.04
337 0.02
338 0.02
339 0.02
340 0.02
341 0.02
342 0.02
343 0.02
344 0.02
345 0.02
346 0.02
347 0.03
348 0.03
349 0.04
350 0.04
351 0.04
352 0.05
353 0.06
354 0.08
355 0.09
356 0.12
357 0.15
358 0.18
359 0.25
360 0.27
361 0.32
362 0.32
363 0.35
364 0.33
365 0.32
366 0.34
367 0.28
368 0.28
369 0.24
370 0.32
371 0.29
372 0.29
373 0.29
374 0.24
375 0.26
376 0.26
377 0.27
378 0.19
379 0.19
380 0.18
381 0.19
382 0.19
383 0.14
384 0.13
385 0.11
386 0.08
387 0.07
388 0.06
389 0.05
390 0.06
391 0.05
392 0.05
393 0.05
394 0.06
395 0.05
396 0.05
397 0.05
398 0.05
399 0.06
400 0.06
401 0.09
402 0.08
403 0.11
404 0.12
405 0.12
406 0.12
407 0.12
408 0.13
409 0.12
410 0.13
411 0.1
412 0.1
413 0.11
414 0.13
415 0.14
416 0.13
417 0.11
418 0.14
419 0.15
420 0.17
421 0.16
422 0.16
423 0.16
424 0.17
425 0.16
426 0.13
427 0.11
428 0.1
429 0.1
430 0.11
431 0.1
432 0.1
433 0.09
434 0.11
435 0.14
436 0.21
437 0.23
438 0.23
439 0.27
440 0.28
441 0.36
442 0.34
443 0.34
444 0.27
445 0.25
446 0.25
447 0.28
448 0.29
449 0.23
450 0.26
451 0.26
452 0.25
453 0.26
454 0.25
455 0.18
456 0.18
457 0.16
458 0.12
459 0.1
460 0.09
461 0.08
462 0.08
463 0.07
464 0.05
465 0.08
466 0.1
467 0.11
468 0.11
469 0.11
470 0.11
471 0.11
472 0.12
473 0.09
474 0.09
475 0.1
476 0.11
477 0.13
478 0.13
479 0.18
480 0.21
481 0.22