Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0VYE5

Protein Details
Accession A0A4T0VYE5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
170-189GTNYWRQRRGEKKLRFITAGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 4, pero 2, nucl 1, cyto 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MRDAGIQARRNLALGTPQPVHLPLVVGLNLLTALARNTRLMGFDKHSICYDEYISPFNLQGPGLPCAPRDASSWPPFLHPTEAQFTITHHPFLDVFPIPSLRENGIRAEELGFFDEDDFCRDVFSTDDDPDGPRLLVWGESWDPRGWEANVPFLKKWGWLVRGCPELLEGTNYWRQRRGEKKLRFITAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.26
4 0.26
5 0.26
6 0.27
7 0.27
8 0.19
9 0.18
10 0.13
11 0.14
12 0.14
13 0.12
14 0.11
15 0.1
16 0.09
17 0.08
18 0.07
19 0.04
20 0.05
21 0.07
22 0.08
23 0.08
24 0.1
25 0.11
26 0.13
27 0.16
28 0.18
29 0.21
30 0.27
31 0.28
32 0.28
33 0.29
34 0.29
35 0.27
36 0.25
37 0.23
38 0.19
39 0.19
40 0.19
41 0.19
42 0.17
43 0.17
44 0.16
45 0.15
46 0.11
47 0.13
48 0.13
49 0.14
50 0.15
51 0.15
52 0.15
53 0.16
54 0.17
55 0.16
56 0.15
57 0.17
58 0.23
59 0.26
60 0.28
61 0.26
62 0.27
63 0.27
64 0.26
65 0.26
66 0.19
67 0.19
68 0.2
69 0.2
70 0.2
71 0.18
72 0.19
73 0.2
74 0.2
75 0.18
76 0.14
77 0.14
78 0.13
79 0.13
80 0.15
81 0.1
82 0.09
83 0.09
84 0.1
85 0.1
86 0.11
87 0.12
88 0.1
89 0.11
90 0.12
91 0.13
92 0.13
93 0.13
94 0.13
95 0.12
96 0.12
97 0.1
98 0.1
99 0.09
100 0.08
101 0.08
102 0.08
103 0.07
104 0.09
105 0.1
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.13
112 0.13
113 0.13
114 0.14
115 0.14
116 0.15
117 0.15
118 0.16
119 0.11
120 0.09
121 0.09
122 0.08
123 0.08
124 0.07
125 0.1
126 0.11
127 0.12
128 0.15
129 0.15
130 0.15
131 0.16
132 0.19
133 0.17
134 0.21
135 0.2
136 0.27
137 0.3
138 0.32
139 0.31
140 0.3
141 0.29
142 0.25
143 0.3
144 0.28
145 0.3
146 0.3
147 0.35
148 0.39
149 0.42
150 0.41
151 0.35
152 0.29
153 0.26
154 0.24
155 0.23
156 0.17
157 0.19
158 0.26
159 0.3
160 0.32
161 0.36
162 0.38
163 0.45
164 0.54
165 0.6
166 0.63
167 0.69
168 0.77
169 0.8