Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0VXI5

Protein Details
Accession A0A4T0VXI5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-52GSPPRSAKKNKHRKGGHGKKNGBasic
NLS Segment(s)
PositionSequence
32-51SPPRSAKKNKHRKGGHGKKN
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 10
Family & Domain DBs
Amino Acid Sequences MPSQSKKTKPTPAAPPSSLDHDASSTVARSGSPPRSAKKNKHRKGGHGKKNGGPSTSDVGFEVSYMGGQFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.62
3 0.55
4 0.54
5 0.48
6 0.38
7 0.3
8 0.23
9 0.22
10 0.19
11 0.17
12 0.11
13 0.09
14 0.08
15 0.08
16 0.09
17 0.14
18 0.17
19 0.22
20 0.25
21 0.28
22 0.38
23 0.45
24 0.53
25 0.58
26 0.66
27 0.67
28 0.75
29 0.76
30 0.76
31 0.81
32 0.82
33 0.81
34 0.8
35 0.77
36 0.72
37 0.77
38 0.69
39 0.59
40 0.5
41 0.43
42 0.39
43 0.34
44 0.3
45 0.21
46 0.2
47 0.18
48 0.17
49 0.13
50 0.08
51 0.08
52 0.07