Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4T0VKU9

Protein Details
Accession A0A4T0VKU9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
240-262TPERRREKGKGQRRSKAPQRPAGBasic
300-343MVDTPEKKMQRHRRARMEIRTAKIERKAKKRERDMRDRVRGLQPBasic
NLS Segment(s)
PositionSequence
104-126ARDAKAEAGKPPPRVPPPEKPKW
242-260ERRREKGKGQRRSKAPQRP
306-337KKMQRHRRARMEIRTAKIERKAKKRERDMRDR
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
Amino Acid Sequences MPPSQFIPARSSRHRIACIALYRALIREARAIPVPDELLRKGTQNPIPRLVRKAFVRNRTETSYRIVFSALGTGYNFLNLFKAAQTPDSTEHSQIIAHLREKSARDAKAEAGKPPPRVPPPEKPKWPPLLQKVSREGQPPAYVSPRYPVPRENLTGARRVPRLVVTAEGIAFLRQGKPQHRSVVRYVQRATKARRQAMELMLTSKREEAPWAALEDRWDEIVGEEVQAAEARRREVDEDTPERRREKGKGQRRSKAPQRPAGAEETYAGRSRAFVAIREAEKQMLEEEERVDLARGHRWMVDTPEKKMQRHRRARMEIRTAKIERKAKKRERDMRDRVRGLQPAPVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.56
3 0.53
4 0.53
5 0.51
6 0.48
7 0.43
8 0.37
9 0.34
10 0.33
11 0.32
12 0.26
13 0.22
14 0.24
15 0.23
16 0.25
17 0.28
18 0.28
19 0.25
20 0.27
21 0.27
22 0.24
23 0.26
24 0.24
25 0.24
26 0.24
27 0.25
28 0.26
29 0.32
30 0.35
31 0.41
32 0.45
33 0.5
34 0.57
35 0.58
36 0.61
37 0.57
38 0.57
39 0.54
40 0.6
41 0.59
42 0.62
43 0.65
44 0.63
45 0.65
46 0.65
47 0.62
48 0.53
49 0.5
50 0.45
51 0.39
52 0.34
53 0.29
54 0.23
55 0.2
56 0.21
57 0.15
58 0.12
59 0.11
60 0.12
61 0.11
62 0.12
63 0.12
64 0.08
65 0.09
66 0.08
67 0.09
68 0.08
69 0.11
70 0.11
71 0.13
72 0.14
73 0.16
74 0.19
75 0.24
76 0.25
77 0.23
78 0.23
79 0.22
80 0.2
81 0.19
82 0.21
83 0.19
84 0.2
85 0.2
86 0.21
87 0.24
88 0.26
89 0.32
90 0.34
91 0.32
92 0.32
93 0.32
94 0.35
95 0.4
96 0.39
97 0.35
98 0.37
99 0.4
100 0.4
101 0.42
102 0.45
103 0.41
104 0.47
105 0.51
106 0.53
107 0.57
108 0.64
109 0.69
110 0.67
111 0.71
112 0.7
113 0.7
114 0.67
115 0.67
116 0.68
117 0.65
118 0.65
119 0.62
120 0.57
121 0.55
122 0.49
123 0.42
124 0.34
125 0.32
126 0.27
127 0.24
128 0.24
129 0.22
130 0.19
131 0.2
132 0.22
133 0.23
134 0.24
135 0.24
136 0.25
137 0.29
138 0.31
139 0.32
140 0.33
141 0.31
142 0.34
143 0.33
144 0.33
145 0.3
146 0.28
147 0.25
148 0.2
149 0.2
150 0.16
151 0.16
152 0.12
153 0.11
154 0.11
155 0.1
156 0.09
157 0.07
158 0.07
159 0.06
160 0.06
161 0.08
162 0.12
163 0.16
164 0.21
165 0.24
166 0.32
167 0.34
168 0.37
169 0.39
170 0.46
171 0.46
172 0.47
173 0.45
174 0.43
175 0.46
176 0.49
177 0.5
178 0.48
179 0.5
180 0.5
181 0.49
182 0.47
183 0.45
184 0.41
185 0.39
186 0.32
187 0.27
188 0.24
189 0.24
190 0.21
191 0.18
192 0.16
193 0.12
194 0.13
195 0.11
196 0.13
197 0.13
198 0.14
199 0.14
200 0.14
201 0.14
202 0.14
203 0.13
204 0.11
205 0.1
206 0.08
207 0.07
208 0.09
209 0.09
210 0.07
211 0.07
212 0.06
213 0.06
214 0.08
215 0.08
216 0.08
217 0.09
218 0.11
219 0.11
220 0.12
221 0.14
222 0.16
223 0.21
224 0.26
225 0.31
226 0.36
227 0.42
228 0.45
229 0.44
230 0.45
231 0.44
232 0.42
233 0.46
234 0.51
235 0.55
236 0.63
237 0.71
238 0.76
239 0.79
240 0.84
241 0.83
242 0.83
243 0.82
244 0.79
245 0.75
246 0.7
247 0.65
248 0.6
249 0.5
250 0.4
251 0.33
252 0.27
253 0.24
254 0.22
255 0.19
256 0.14
257 0.13
258 0.15
259 0.19
260 0.17
261 0.16
262 0.2
263 0.26
264 0.27
265 0.3
266 0.29
267 0.25
268 0.24
269 0.23
270 0.19
271 0.16
272 0.16
273 0.14
274 0.14
275 0.14
276 0.14
277 0.14
278 0.14
279 0.13
280 0.14
281 0.18
282 0.19
283 0.19
284 0.2
285 0.22
286 0.24
287 0.29
288 0.37
289 0.35
290 0.39
291 0.47
292 0.51
293 0.53
294 0.62
295 0.65
296 0.66
297 0.74
298 0.79
299 0.8
300 0.85
301 0.91
302 0.9
303 0.9
304 0.87
305 0.82
306 0.81
307 0.73
308 0.7
309 0.69
310 0.67
311 0.65
312 0.68
313 0.74
314 0.75
315 0.82
316 0.86
317 0.87
318 0.89
319 0.91
320 0.92
321 0.92
322 0.92
323 0.87
324 0.82
325 0.8
326 0.76
327 0.66
328 0.62