Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SJ13

Protein Details
Accession A0A4V3SJ13   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKRKPTSSGRPAKRTRRTKELPALIKHydrophilic
NLS Segment(s)
PositionSequence
4-21KRKPTSSGRPAKRTRRTK
Subcellular Location(s) mito_nucl 14.333, nucl 13.5, mito 13, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MPPKRKPTSSGRPAKRTRRTKELPALIKQSSKLQLDLSNPSDPIAKLDDLCLDLIFQHLNLKDLIVVSAVSKLWRLSVPAEIGMEQDLSKRCVMWRRCASGHVLRELARPLKAIKVKNIPWGIFDISGPYIAWVELGMDKYKYKWAEAYFEGMNEYILSHRRDISNIFRRRLISA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.89
4 0.86
5 0.86
6 0.83
7 0.83
8 0.84
9 0.83
10 0.79
11 0.75
12 0.74
13 0.66
14 0.61
15 0.52
16 0.48
17 0.45
18 0.39
19 0.33
20 0.3
21 0.31
22 0.32
23 0.36
24 0.34
25 0.29
26 0.28
27 0.27
28 0.27
29 0.23
30 0.21
31 0.18
32 0.15
33 0.13
34 0.14
35 0.15
36 0.13
37 0.14
38 0.11
39 0.08
40 0.07
41 0.08
42 0.07
43 0.06
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.09
64 0.11
65 0.11
66 0.11
67 0.12
68 0.1
69 0.1
70 0.09
71 0.08
72 0.06
73 0.08
74 0.08
75 0.09
76 0.09
77 0.09
78 0.11
79 0.19
80 0.22
81 0.29
82 0.34
83 0.38
84 0.39
85 0.4
86 0.43
87 0.42
88 0.42
89 0.34
90 0.3
91 0.26
92 0.26
93 0.28
94 0.25
95 0.18
96 0.17
97 0.16
98 0.21
99 0.26
100 0.26
101 0.3
102 0.36
103 0.38
104 0.45
105 0.48
106 0.42
107 0.37
108 0.38
109 0.33
110 0.25
111 0.23
112 0.17
113 0.13
114 0.13
115 0.12
116 0.09
117 0.08
118 0.07
119 0.07
120 0.05
121 0.06
122 0.07
123 0.09
124 0.1
125 0.11
126 0.12
127 0.13
128 0.2
129 0.2
130 0.2
131 0.24
132 0.25
133 0.29
134 0.3
135 0.33
136 0.27
137 0.27
138 0.26
139 0.21
140 0.18
141 0.13
142 0.12
143 0.1
144 0.14
145 0.16
146 0.17
147 0.2
148 0.22
149 0.24
150 0.28
151 0.36
152 0.42
153 0.48
154 0.5
155 0.51