Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N5S2

Protein Details
Accession A0A4S2N5S2    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-117QCQYVPKKEPQLDKKKKEFEEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MSSSQSSRNPLRPYYIPPAAGDIDLPAPPPPRVYRSSPVAPAPSSSSLISDFNDYSSEFLEAPSVSDSIKNFANHALLTYTSVLVSQPFQVAKTVLQCQYVPKKEPQLDKKKKEFEEMFGESFDELSDEESDDEVRYFQSNAESPEESPSLRPQKRGMKKMTDRAGYVLEDQKDTDIPRPEYQIKLVREGAVGETLKCLWQKEGAWGIWKGTNSTFIYTMATSTLESWMSSFLSAILSISDAGVADIADSTHPLASLAVAVTASALTALLLSPLDIIRTKLIITPSSSKPRNLVPSLRALPSYTIPPSLIVPTTLHAVIPSLISIGAPYFLKTKLLLDPIANPTTFSFCSVIASTIELFVRLPLETILRRAQVAEAKPEKTVVPIGRYAGVVGTAWVVLKEEESGKWGFEGLYRGWRVGAWGNVGVLGLGFIGVQGAQAGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.49
4 0.44
5 0.46
6 0.41
7 0.37
8 0.29
9 0.21
10 0.18
11 0.16
12 0.16
13 0.15
14 0.16
15 0.17
16 0.22
17 0.24
18 0.28
19 0.33
20 0.39
21 0.43
22 0.48
23 0.54
24 0.54
25 0.54
26 0.53
27 0.48
28 0.43
29 0.41
30 0.37
31 0.33
32 0.28
33 0.24
34 0.22
35 0.23
36 0.22
37 0.2
38 0.17
39 0.16
40 0.17
41 0.15
42 0.14
43 0.14
44 0.14
45 0.11
46 0.1
47 0.12
48 0.1
49 0.11
50 0.12
51 0.11
52 0.1
53 0.13
54 0.13
55 0.14
56 0.19
57 0.18
58 0.17
59 0.19
60 0.21
61 0.18
62 0.19
63 0.17
64 0.13
65 0.15
66 0.15
67 0.13
68 0.11
69 0.11
70 0.1
71 0.1
72 0.1
73 0.1
74 0.12
75 0.12
76 0.13
77 0.14
78 0.15
79 0.16
80 0.19
81 0.24
82 0.23
83 0.25
84 0.25
85 0.31
86 0.4
87 0.44
88 0.43
89 0.43
90 0.5
91 0.54
92 0.63
93 0.66
94 0.68
95 0.73
96 0.78
97 0.83
98 0.83
99 0.78
100 0.78
101 0.7
102 0.64
103 0.61
104 0.56
105 0.47
106 0.38
107 0.36
108 0.27
109 0.24
110 0.18
111 0.1
112 0.06
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.08
124 0.08
125 0.09
126 0.11
127 0.13
128 0.16
129 0.19
130 0.19
131 0.19
132 0.22
133 0.22
134 0.19
135 0.18
136 0.24
137 0.3
138 0.32
139 0.34
140 0.37
141 0.47
142 0.55
143 0.63
144 0.62
145 0.62
146 0.67
147 0.73
148 0.74
149 0.66
150 0.57
151 0.51
152 0.46
153 0.36
154 0.32
155 0.28
156 0.21
157 0.19
158 0.18
159 0.17
160 0.16
161 0.16
162 0.19
163 0.2
164 0.23
165 0.24
166 0.29
167 0.3
168 0.3
169 0.33
170 0.36
171 0.31
172 0.32
173 0.31
174 0.27
175 0.25
176 0.24
177 0.2
178 0.16
179 0.15
180 0.11
181 0.1
182 0.1
183 0.11
184 0.12
185 0.12
186 0.08
187 0.11
188 0.12
189 0.15
190 0.19
191 0.18
192 0.2
193 0.2
194 0.2
195 0.2
196 0.19
197 0.16
198 0.13
199 0.17
200 0.15
201 0.16
202 0.15
203 0.13
204 0.14
205 0.13
206 0.13
207 0.08
208 0.08
209 0.07
210 0.07
211 0.07
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.03
251 0.02
252 0.02
253 0.02
254 0.02
255 0.02
256 0.03
257 0.03
258 0.03
259 0.04
260 0.04
261 0.05
262 0.05
263 0.06
264 0.07
265 0.08
266 0.08
267 0.1
268 0.12
269 0.13
270 0.16
271 0.21
272 0.26
273 0.35
274 0.36
275 0.35
276 0.35
277 0.39
278 0.43
279 0.41
280 0.4
281 0.34
282 0.4
283 0.42
284 0.41
285 0.36
286 0.3
287 0.28
288 0.24
289 0.25
290 0.18
291 0.16
292 0.15
293 0.15
294 0.15
295 0.15
296 0.14
297 0.12
298 0.11
299 0.11
300 0.13
301 0.12
302 0.11
303 0.09
304 0.1
305 0.09
306 0.08
307 0.07
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.06
314 0.06
315 0.07
316 0.08
317 0.09
318 0.11
319 0.11
320 0.13
321 0.16
322 0.19
323 0.19
324 0.18
325 0.23
326 0.27
327 0.29
328 0.27
329 0.24
330 0.22
331 0.24
332 0.23
333 0.21
334 0.16
335 0.14
336 0.17
337 0.17
338 0.17
339 0.13
340 0.14
341 0.12
342 0.13
343 0.13
344 0.1
345 0.1
346 0.09
347 0.1
348 0.08
349 0.08
350 0.08
351 0.12
352 0.13
353 0.17
354 0.2
355 0.2
356 0.21
357 0.21
358 0.24
359 0.26
360 0.28
361 0.34
362 0.35
363 0.35
364 0.35
365 0.36
366 0.33
367 0.28
368 0.33
369 0.27
370 0.25
371 0.27
372 0.28
373 0.28
374 0.28
375 0.26
376 0.19
377 0.16
378 0.12
379 0.09
380 0.08
381 0.07
382 0.07
383 0.07
384 0.07
385 0.07
386 0.07
387 0.09
388 0.11
389 0.11
390 0.14
391 0.15
392 0.14
393 0.14
394 0.15
395 0.13
396 0.14
397 0.17
398 0.17
399 0.25
400 0.25
401 0.26
402 0.25
403 0.25
404 0.25
405 0.26
406 0.27
407 0.22
408 0.22
409 0.21
410 0.21
411 0.21
412 0.17
413 0.12
414 0.09
415 0.05
416 0.04
417 0.03
418 0.03
419 0.03
420 0.03
421 0.04
422 0.04