Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MUJ4

Protein Details
Accession A0A4S2MUJ4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
218-243SLNSVYRNKEFRKKWKGKFRVILLDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007681  Mog1  
IPR021139  NYN  
Gene Ontology GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF01936  NYN  
CDD cd18724  PIN_LabA-like  
Amino Acid Sequences KKPVIKSSISWEQRKSVLVQKLLNQFPDNKSTILKPSRSDSTQRQSNDIHVFVDNSNISIGFIDHIKASRGLKTVNISRPVLSFRALSLILERGRPAVRRVLVGSAPFTREMIEAKEIGYETSVLERVEKDRPDNGQRSASSGSDTAANKIRRRKVEQGVDEILHMKICESLLDHNPSTVVLASGDGNIAEYSPGFFKAIERCLDRNWRVEVVAFKNSLNSVYRNKEFRKKWKGKFRVILLDDFAEDMLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.45
4 0.44
5 0.44
6 0.45
7 0.48
8 0.54
9 0.54
10 0.54
11 0.47
12 0.45
13 0.43
14 0.46
15 0.4
16 0.33
17 0.32
18 0.32
19 0.38
20 0.4
21 0.4
22 0.37
23 0.4
24 0.46
25 0.47
26 0.51
27 0.5
28 0.53
29 0.57
30 0.55
31 0.54
32 0.49
33 0.52
34 0.5
35 0.42
36 0.34
37 0.27
38 0.27
39 0.23
40 0.26
41 0.18
42 0.14
43 0.13
44 0.12
45 0.11
46 0.09
47 0.09
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.12
55 0.13
56 0.16
57 0.17
58 0.18
59 0.2
60 0.24
61 0.31
62 0.34
63 0.37
64 0.35
65 0.33
66 0.34
67 0.34
68 0.3
69 0.23
70 0.17
71 0.13
72 0.15
73 0.14
74 0.13
75 0.11
76 0.14
77 0.14
78 0.14
79 0.14
80 0.13
81 0.15
82 0.17
83 0.17
84 0.19
85 0.19
86 0.2
87 0.21
88 0.21
89 0.21
90 0.2
91 0.2
92 0.15
93 0.16
94 0.14
95 0.13
96 0.11
97 0.11
98 0.11
99 0.1
100 0.1
101 0.09
102 0.09
103 0.1
104 0.09
105 0.09
106 0.08
107 0.06
108 0.05
109 0.06
110 0.07
111 0.06
112 0.07
113 0.07
114 0.09
115 0.13
116 0.14
117 0.15
118 0.17
119 0.21
120 0.27
121 0.3
122 0.31
123 0.31
124 0.3
125 0.32
126 0.3
127 0.27
128 0.21
129 0.18
130 0.16
131 0.16
132 0.16
133 0.15
134 0.21
135 0.25
136 0.28
137 0.35
138 0.41
139 0.43
140 0.49
141 0.56
142 0.58
143 0.63
144 0.62
145 0.6
146 0.56
147 0.5
148 0.44
149 0.36
150 0.27
151 0.18
152 0.15
153 0.09
154 0.07
155 0.07
156 0.07
157 0.07
158 0.11
159 0.15
160 0.2
161 0.2
162 0.19
163 0.19
164 0.18
165 0.18
166 0.14
167 0.1
168 0.05
169 0.06
170 0.06
171 0.06
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.06
180 0.06
181 0.08
182 0.07
183 0.08
184 0.11
185 0.16
186 0.2
187 0.23
188 0.27
189 0.28
190 0.34
191 0.43
192 0.43
193 0.43
194 0.43
195 0.4
196 0.36
197 0.37
198 0.38
199 0.34
200 0.35
201 0.31
202 0.28
203 0.28
204 0.28
205 0.28
206 0.24
207 0.23
208 0.26
209 0.33
210 0.39
211 0.45
212 0.51
213 0.59
214 0.65
215 0.72
216 0.76
217 0.78
218 0.83
219 0.86
220 0.89
221 0.9
222 0.9
223 0.87
224 0.86
225 0.79
226 0.72
227 0.64
228 0.56
229 0.45
230 0.36