Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MUR7

Protein Details
Accession A0A4S2MUR7    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPGAPRGKRKPVRGKGKSFSRNLRPLDHydrophilic
NLS Segment(s)
PositionSequence
5-19APRGKRKPVRGKGKS
75-88RRAAAKARKEAAKA
174-213RKEREEKALMRKAELEEKKRVAEEKANERLGKGKAPSKRR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
IPR039876  HAP28  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MAPGAPRGKRKPVRGKGKSFSRNLRPLDDEDTSIVPVDSGSEDENESGSEGSDSDGAPGPSTSTDATAEMSREERRAAAKARKEAAKARNAGPVQSDEESEGETAAPAIKKLEKGVGGIRISNPNDPRNATGEPSRREKEAMAAAAAKERYWKLQQEGKTDQAKADLARLAQIRKEREEKALMRKAELEEKKRVAEEKANERLGKGKAPSKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.87
4 0.89
5 0.88
6 0.85
7 0.84
8 0.82
9 0.81
10 0.75
11 0.71
12 0.64
13 0.58
14 0.56
15 0.48
16 0.39
17 0.33
18 0.31
19 0.26
20 0.22
21 0.18
22 0.11
23 0.09
24 0.09
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.09
33 0.09
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.08
42 0.1
43 0.1
44 0.1
45 0.1
46 0.1
47 0.09
48 0.11
49 0.1
50 0.08
51 0.09
52 0.09
53 0.11
54 0.11
55 0.11
56 0.1
57 0.13
58 0.13
59 0.13
60 0.13
61 0.13
62 0.14
63 0.17
64 0.23
65 0.29
66 0.33
67 0.38
68 0.42
69 0.44
70 0.44
71 0.48
72 0.48
73 0.47
74 0.44
75 0.4
76 0.43
77 0.4
78 0.38
79 0.31
80 0.27
81 0.23
82 0.2
83 0.19
84 0.12
85 0.12
86 0.12
87 0.11
88 0.09
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.08
99 0.11
100 0.1
101 0.11
102 0.13
103 0.18
104 0.17
105 0.17
106 0.18
107 0.21
108 0.22
109 0.25
110 0.27
111 0.24
112 0.25
113 0.26
114 0.26
115 0.24
116 0.24
117 0.22
118 0.25
119 0.3
120 0.32
121 0.38
122 0.38
123 0.35
124 0.35
125 0.33
126 0.3
127 0.27
128 0.24
129 0.18
130 0.18
131 0.17
132 0.2
133 0.2
134 0.15
135 0.14
136 0.14
137 0.18
138 0.21
139 0.24
140 0.26
141 0.32
142 0.37
143 0.42
144 0.46
145 0.48
146 0.49
147 0.46
148 0.41
149 0.37
150 0.34
151 0.27
152 0.25
153 0.2
154 0.15
155 0.19
156 0.21
157 0.21
158 0.23
159 0.29
160 0.3
161 0.34
162 0.4
163 0.38
164 0.41
165 0.47
166 0.49
167 0.54
168 0.57
169 0.52
170 0.48
171 0.49
172 0.47
173 0.49
174 0.51
175 0.47
176 0.47
177 0.5
178 0.51
179 0.5
180 0.49
181 0.44
182 0.44
183 0.47
184 0.49
185 0.54
186 0.57
187 0.55
188 0.53
189 0.54
190 0.49
191 0.47
192 0.43
193 0.42