Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N4F3

Protein Details
Accession A0A4S2N4F3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GDAAKRERASRQQRKQRKNKAKELRGTAKVKBasic
NLS Segment(s)
PositionSequence
99-133AKRERASRQQRKQRKNKAKELRGTAKVKGAKKRKE
Subcellular Location(s) mito 15.5, cyto_mito 11, nucl 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFMRNALLARKQMVVDILHPGRANISKDDLRAKLAELYKSDKAAVSVFGLRTHYGGGKTTGFALIYDSHDDLKKFEPQYRLVRYGDAAKRERASRQQRKQRKNKAKELRGTAKVKGAKKRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.58
4 0.63
5 0.66
6 0.62
7 0.57
8 0.52
9 0.45
10 0.36
11 0.32
12 0.24
13 0.16
14 0.22
15 0.2
16 0.21
17 0.21
18 0.2
19 0.2
20 0.23
21 0.24
22 0.18
23 0.23
24 0.22
25 0.25
26 0.3
27 0.28
28 0.26
29 0.24
30 0.23
31 0.24
32 0.25
33 0.25
34 0.22
35 0.26
36 0.25
37 0.26
38 0.25
39 0.19
40 0.17
41 0.15
42 0.14
43 0.1
44 0.11
45 0.11
46 0.11
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.1
55 0.09
56 0.09
57 0.1
58 0.09
59 0.08
60 0.07
61 0.08
62 0.08
63 0.09
64 0.1
65 0.1
66 0.11
67 0.13
68 0.13
69 0.13
70 0.14
71 0.19
72 0.19
73 0.24
74 0.26
75 0.31
76 0.4
77 0.44
78 0.46
79 0.4
80 0.4
81 0.36
82 0.41
83 0.39
84 0.38
85 0.35
86 0.35
87 0.37
88 0.39
89 0.43
90 0.44
91 0.52
92 0.55
93 0.63
94 0.71
95 0.78
96 0.87
97 0.92
98 0.94
99 0.94
100 0.93
101 0.93
102 0.93
103 0.92
104 0.9
105 0.89
106 0.87
107 0.85
108 0.79
109 0.71
110 0.68
111 0.65
112 0.64
113 0.64