Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MNL0

Protein Details
Accession A0A4S2MNL0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-66VTKGKGFTKEKNKKKKGAYRGGABasic
NLS Segment(s)
PositionSequence
48-61KGFTKEKNKKKKGA
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 11, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences NKRFSRIDMSKVAYERDGLEDNTFLAAGFDETHYSFKAHQDLIVTKGKGFTKEKNKKKKGAYRGGAIDFTTRSIKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.25
4 0.22
5 0.18
6 0.18
7 0.16
8 0.15
9 0.15
10 0.13
11 0.09
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.06
18 0.07
19 0.08
20 0.09
21 0.1
22 0.1
23 0.11
24 0.14
25 0.13
26 0.13
27 0.14
28 0.14
29 0.18
30 0.22
31 0.2
32 0.18
33 0.22
34 0.22
35 0.25
36 0.28
37 0.32
38 0.38
39 0.49
40 0.59
41 0.66
42 0.73
43 0.76
44 0.83
45 0.84
46 0.83
47 0.84
48 0.8
49 0.76
50 0.75
51 0.7
52 0.61
53 0.52
54 0.44
55 0.33
56 0.3
57 0.28
58 0.21