Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MHR5

Protein Details
Accession A0A4S2MHR5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
99-122AGPQAGLKRRSRSRRPIQLQQLSRHydrophilic
NLS Segment(s)
PositionSequence
105-113LKRRSRSRR
Subcellular Location(s) extr 10, plas 6, nucl 5, mito 4
Family & Domain DBs
Amino Acid Sequences MMLKTHANRLVTITFPLSSIPPIHRHHRLLLLLLLLFLLLYHSHLLRHPHHPPSSSAIHHHHPLPTSPSATQNSYGPSSDAPTRRRRLSPTPPPQPFSAGPQAGLKRRSRSRRPIQLQQLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.15
5 0.15
6 0.16
7 0.17
8 0.22
9 0.27
10 0.34
11 0.4
12 0.42
13 0.43
14 0.46
15 0.44
16 0.39
17 0.35
18 0.29
19 0.22
20 0.19
21 0.15
22 0.09
23 0.07
24 0.05
25 0.05
26 0.03
27 0.04
28 0.05
29 0.06
30 0.07
31 0.09
32 0.15
33 0.17
34 0.24
35 0.28
36 0.34
37 0.36
38 0.37
39 0.36
40 0.36
41 0.36
42 0.31
43 0.3
44 0.28
45 0.28
46 0.28
47 0.27
48 0.24
49 0.21
50 0.21
51 0.21
52 0.18
53 0.18
54 0.17
55 0.2
56 0.21
57 0.22
58 0.22
59 0.19
60 0.2
61 0.19
62 0.19
63 0.15
64 0.13
65 0.14
66 0.19
67 0.23
68 0.26
69 0.34
70 0.39
71 0.44
72 0.47
73 0.51
74 0.55
75 0.6
76 0.66
77 0.68
78 0.72
79 0.73
80 0.72
81 0.67
82 0.62
83 0.53
84 0.48
85 0.47
86 0.36
87 0.33
88 0.36
89 0.41
90 0.41
91 0.47
92 0.46
93 0.46
94 0.55
95 0.64
96 0.68
97 0.74
98 0.79
99 0.83
100 0.87
101 0.88
102 0.89