Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N3I5

Protein Details
Accession A0A4S2N3I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-73HAWEPRRAINRPKRPRQRPMPVEPLPHydrophilic
NLS Segment(s)
PositionSequence
22-65RGWAKSRGGRERRGFRDHGEGRGLGEHAWEPRRAINRPKRPRQR
Subcellular Location(s) cyto 11, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MFPGLWVAGAAGIRSDRAEEERGWAKSRGGRERRGFRDHGEGRGLGEHAWEPRRAINRPKRPRQRPMPVEPLPEWNGGGVVAACREAVVEYRSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.12
5 0.15
6 0.14
7 0.2
8 0.26
9 0.28
10 0.3
11 0.3
12 0.29
13 0.3
14 0.38
15 0.43
16 0.42
17 0.49
18 0.54
19 0.63
20 0.66
21 0.68
22 0.62
23 0.54
24 0.59
25 0.52
26 0.46
27 0.39
28 0.32
29 0.27
30 0.26
31 0.23
32 0.12
33 0.11
34 0.09
35 0.09
36 0.11
37 0.11
38 0.11
39 0.15
40 0.2
41 0.23
42 0.32
43 0.4
44 0.49
45 0.59
46 0.7
47 0.77
48 0.81
49 0.87
50 0.88
51 0.88
52 0.86
53 0.83
54 0.83
55 0.75
56 0.72
57 0.63
58 0.59
59 0.51
60 0.43
61 0.35
62 0.25
63 0.21
64 0.16
65 0.15
66 0.09
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.09
75 0.11