Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N4R4

Protein Details
Accession A0A4S2N4R4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
58-80ELARMERERLRRRAKRLEQEGGABasic
NLS Segment(s)
PositionSequence
65-72ERLRRRAK
Subcellular Location(s) cysk 20, nucl 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGPNLEVFKFGMYIMFPIAVMYYFGTNLDNRFSVPDFWPRPEETHKIPFERDEIRAELARMERERLRRRAKRLEQEGGAGEQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.08
15 0.09
16 0.1
17 0.1
18 0.09
19 0.11
20 0.12
21 0.13
22 0.14
23 0.22
24 0.22
25 0.24
26 0.27
27 0.26
28 0.28
29 0.3
30 0.32
31 0.28
32 0.34
33 0.35
34 0.34
35 0.33
36 0.31
37 0.31
38 0.3
39 0.27
40 0.22
41 0.21
42 0.22
43 0.22
44 0.21
45 0.2
46 0.19
47 0.22
48 0.2
49 0.23
50 0.25
51 0.34
52 0.43
53 0.5
54 0.59
55 0.62
56 0.7
57 0.78
58 0.83
59 0.84
60 0.84
61 0.82
62 0.73
63 0.69
64 0.63
65 0.54