Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MLY8

Protein Details
Accession A0A4S2MLY8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-55KKSNNKTINLKNKKKKNTALHydrophilic
NLS Segment(s)
PositionSequence
47-51NKKKK
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MVVLKNKTIMDSTVVIAVVAVMRNSMAPNKNNQLEKKSNNKTINLKNKKKKNTALPSPPAQPANPPTSSRPPATSRNGVFTGHHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.11
5 0.08
6 0.07
7 0.06
8 0.04
9 0.05
10 0.05
11 0.06
12 0.11
13 0.15
14 0.16
15 0.22
16 0.28
17 0.33
18 0.38
19 0.4
20 0.42
21 0.45
22 0.49
23 0.54
24 0.55
25 0.58
26 0.56
27 0.58
28 0.59
29 0.61
30 0.66
31 0.66
32 0.7
33 0.7
34 0.76
35 0.8
36 0.8
37 0.78
38 0.78
39 0.77
40 0.77
41 0.78
42 0.74
43 0.7
44 0.66
45 0.62
46 0.53
47 0.43
48 0.38
49 0.33
50 0.33
51 0.32
52 0.31
53 0.33
54 0.4
55 0.45
56 0.42
57 0.43
58 0.43
59 0.47
60 0.52
61 0.55
62 0.48
63 0.51
64 0.5
65 0.46