Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MJS6

Protein Details
Accession A0A4S2MJS6   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
128-148EAHLAKKRKKSAKTKAKEISNHydrophilic
NLS Segment(s)
PositionSequence
115-144RKSAEEEARKATAEAHLAKKRKKSAKTKAK
Subcellular Location(s) cyto_nucl 9.333, nucl 9, cyto 8.5, mito_nucl 6.833, mito 3.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039454  OM14  
IPR039453  OM14_C  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:1990593  F:nascent polypeptide-associated complex binding  
Pfam View protein in Pfam  
PF17304  DUF5353  
Amino Acid Sequences MSYAEAAARGPPQSEEEVSVRHPTTVVKLQQRHGEEDAQLIVLRGCRGRLSRGNADRSYNSRAPPVPEIIPTDRSVDSLIDVDTGIAVVPADFDKQEVKTETQAARIELEQEAKRKSAEEEARKATAEAHLAKKRKKSAKTKAKEISNSPVLLINSLLVTATAGVLGWMGYKKYQAGQLTWKVVGMWTAGVAGVTAADYFISSFLYKKYPPGQKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.22
4 0.24
5 0.25
6 0.3
7 0.27
8 0.23
9 0.23
10 0.2
11 0.24
12 0.3
13 0.35
14 0.38
15 0.43
16 0.47
17 0.54
18 0.56
19 0.55
20 0.49
21 0.45
22 0.37
23 0.33
24 0.29
25 0.22
26 0.19
27 0.15
28 0.12
29 0.11
30 0.12
31 0.11
32 0.11
33 0.14
34 0.16
35 0.22
36 0.28
37 0.34
38 0.42
39 0.49
40 0.55
41 0.54
42 0.56
43 0.53
44 0.5
45 0.51
46 0.44
47 0.38
48 0.35
49 0.35
50 0.35
51 0.34
52 0.33
53 0.26
54 0.25
55 0.28
56 0.27
57 0.27
58 0.25
59 0.25
60 0.22
61 0.21
62 0.2
63 0.15
64 0.13
65 0.11
66 0.1
67 0.07
68 0.07
69 0.06
70 0.05
71 0.05
72 0.04
73 0.03
74 0.03
75 0.02
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.1
84 0.11
85 0.12
86 0.13
87 0.18
88 0.18
89 0.21
90 0.21
91 0.19
92 0.18
93 0.17
94 0.17
95 0.13
96 0.16
97 0.14
98 0.16
99 0.17
100 0.16
101 0.17
102 0.16
103 0.16
104 0.21
105 0.27
106 0.3
107 0.34
108 0.37
109 0.38
110 0.37
111 0.36
112 0.29
113 0.22
114 0.2
115 0.18
116 0.23
117 0.28
118 0.33
119 0.37
120 0.43
121 0.5
122 0.55
123 0.61
124 0.64
125 0.69
126 0.75
127 0.78
128 0.82
129 0.81
130 0.8
131 0.75
132 0.68
133 0.65
134 0.58
135 0.5
136 0.41
137 0.37
138 0.29
139 0.25
140 0.21
141 0.13
142 0.09
143 0.09
144 0.08
145 0.04
146 0.04
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.05
156 0.06
157 0.07
158 0.08
159 0.09
160 0.12
161 0.17
162 0.19
163 0.21
164 0.29
165 0.34
166 0.37
167 0.36
168 0.34
169 0.29
170 0.27
171 0.24
172 0.17
173 0.11
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.05
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.04
186 0.04
187 0.05
188 0.07
189 0.07
190 0.08
191 0.11
192 0.16
193 0.17
194 0.24
195 0.33
196 0.42