Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MV75

Protein Details
Accession A0A4S2MV75   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-41RPPTFPLSHASRQKPRKWPLAFRFIKHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021134  Bestrophin-like  
IPR044669  YneE/VCCN1/2-like  
Gene Ontology GO:0016020  C:membrane  
GO:0005254  F:chloride channel activity  
Pfam View protein in Pfam  
PF01062  Bestrophin  
Amino Acid Sequences MSNLPITNGANGAVPRPPTFPLSHASRQKPRKWPLAFRFIKGAIHHVIIVPIAFHALFTALIVHIDINLDHNLGVPSSIVPSLSIVVGLMLVFRNSSSYERYWGGRTNLQKIVTCVRNLTRSFLVCGPNDHEEDRYETEKTVRCLVAILYAVKNYLRGNWGLTIAYEPEYEGLVPKGLKGHESEGVGLPLELAFFVERYIKRGVERGSFNAPQSSMLSGQVNSIMDAFGAMETIKLTPIPVCHQIHQKQVLGLYCCVLPFCLVDDLGWWTVPVISMVCFTLYGIEGIGEELEDPFGVDKNDIKIDAILEDVRQEVMSQLDSWKKCGEEYTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.23
5 0.24
6 0.26
7 0.26
8 0.29
9 0.35
10 0.42
11 0.49
12 0.56
13 0.62
14 0.7
15 0.76
16 0.8
17 0.8
18 0.81
19 0.8
20 0.82
21 0.81
22 0.82
23 0.77
24 0.69
25 0.68
26 0.59
27 0.55
28 0.45
29 0.42
30 0.33
31 0.3
32 0.28
33 0.22
34 0.2
35 0.16
36 0.15
37 0.1
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.05
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.05
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.09
62 0.06
63 0.06
64 0.07
65 0.08
66 0.06
67 0.06
68 0.07
69 0.08
70 0.07
71 0.07
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.07
83 0.09
84 0.13
85 0.14
86 0.17
87 0.19
88 0.21
89 0.23
90 0.26
91 0.28
92 0.29
93 0.32
94 0.34
95 0.37
96 0.37
97 0.36
98 0.33
99 0.37
100 0.34
101 0.31
102 0.28
103 0.27
104 0.31
105 0.31
106 0.32
107 0.28
108 0.26
109 0.28
110 0.28
111 0.29
112 0.23
113 0.24
114 0.24
115 0.24
116 0.24
117 0.22
118 0.2
119 0.17
120 0.2
121 0.21
122 0.2
123 0.18
124 0.17
125 0.21
126 0.23
127 0.23
128 0.24
129 0.21
130 0.19
131 0.18
132 0.18
133 0.16
134 0.14
135 0.14
136 0.1
137 0.1
138 0.1
139 0.1
140 0.11
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.1
147 0.11
148 0.1
149 0.1
150 0.09
151 0.08
152 0.09
153 0.07
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.06
161 0.06
162 0.06
163 0.08
164 0.08
165 0.09
166 0.1
167 0.12
168 0.13
169 0.14
170 0.15
171 0.13
172 0.13
173 0.12
174 0.11
175 0.09
176 0.06
177 0.05
178 0.04
179 0.03
180 0.03
181 0.03
182 0.04
183 0.09
184 0.09
185 0.13
186 0.15
187 0.16
188 0.16
189 0.21
190 0.24
191 0.24
192 0.27
193 0.27
194 0.31
195 0.32
196 0.32
197 0.29
198 0.26
199 0.22
200 0.2
201 0.19
202 0.13
203 0.13
204 0.13
205 0.12
206 0.12
207 0.12
208 0.12
209 0.1
210 0.09
211 0.08
212 0.06
213 0.06
214 0.06
215 0.04
216 0.04
217 0.03
218 0.03
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.06
225 0.08
226 0.12
227 0.2
228 0.22
229 0.26
230 0.35
231 0.39
232 0.46
233 0.49
234 0.46
235 0.4
236 0.4
237 0.41
238 0.35
239 0.31
240 0.24
241 0.2
242 0.18
243 0.17
244 0.14
245 0.1
246 0.07
247 0.09
248 0.1
249 0.09
250 0.09
251 0.1
252 0.14
253 0.14
254 0.13
255 0.11
256 0.09
257 0.09
258 0.1
259 0.09
260 0.06
261 0.06
262 0.07
263 0.08
264 0.08
265 0.08
266 0.07
267 0.08
268 0.08
269 0.08
270 0.07
271 0.06
272 0.06
273 0.06
274 0.06
275 0.05
276 0.05
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.07
283 0.08
284 0.09
285 0.11
286 0.15
287 0.18
288 0.18
289 0.18
290 0.18
291 0.18
292 0.17
293 0.17
294 0.14
295 0.12
296 0.12
297 0.12
298 0.11
299 0.1
300 0.1
301 0.09
302 0.1
303 0.11
304 0.12
305 0.17
306 0.25
307 0.26
308 0.29
309 0.31
310 0.3
311 0.29