Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MPZ7

Protein Details
Accession A0A4S2MPZ7   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-30KVKVKIQQKRLCRKHYASKKRNTKHQTHMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MKVKVKIQQKRLCRKHYASKKRNTKHQTHMEGATKNNNDNIKTQNRKTLEHPKPRIMSLSIMSHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.83
4 0.84
5 0.83
6 0.84
7 0.87
8 0.85
9 0.88
10 0.84
11 0.81
12 0.79
13 0.79
14 0.75
15 0.67
16 0.65
17 0.59
18 0.53
19 0.47
20 0.43
21 0.34
22 0.29
23 0.29
24 0.27
25 0.23
26 0.24
27 0.29
28 0.32
29 0.39
30 0.4
31 0.44
32 0.45
33 0.47
34 0.52
35 0.57
36 0.57
37 0.61
38 0.65
39 0.66
40 0.66
41 0.65
42 0.61
43 0.52
44 0.46
45 0.39
46 0.38