Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N7T6

Protein Details
Accession A0A4S2N7T6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
107-133VGGNKTKGGRVDKKKGKKGRNERKVLGBasic
NLS Segment(s)
PositionSequence
111-132KTKGGRVDKKKGKKGRNERKVL
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MRHGGGQTWTDSSLLEWDPSHFRLFVGNLAGEVTDDSLLKAFSKYPSVKKARVIRDKRTTKSKGYGFVAFADGDEYFKAAREMQGKYIGSHPVLLKRSNTEIKPVVVGGNKTKGGRVDKKKGKKGRNERKVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.15
5 0.19
6 0.21
7 0.22
8 0.18
9 0.17
10 0.19
11 0.19
12 0.19
13 0.17
14 0.16
15 0.14
16 0.14
17 0.13
18 0.1
19 0.09
20 0.07
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.07
27 0.07
28 0.08
29 0.09
30 0.16
31 0.2
32 0.25
33 0.34
34 0.39
35 0.42
36 0.48
37 0.55
38 0.58
39 0.65
40 0.67
41 0.67
42 0.71
43 0.76
44 0.73
45 0.74
46 0.68
47 0.62
48 0.62
49 0.56
50 0.51
51 0.46
52 0.43
53 0.34
54 0.31
55 0.27
56 0.2
57 0.17
58 0.12
59 0.09
60 0.07
61 0.06
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.09
68 0.13
69 0.14
70 0.16
71 0.22
72 0.23
73 0.23
74 0.25
75 0.24
76 0.2
77 0.22
78 0.21
79 0.22
80 0.24
81 0.25
82 0.24
83 0.25
84 0.31
85 0.35
86 0.34
87 0.34
88 0.34
89 0.33
90 0.32
91 0.3
92 0.26
93 0.23
94 0.25
95 0.23
96 0.27
97 0.29
98 0.28
99 0.3
100 0.32
101 0.38
102 0.46
103 0.51
104 0.57
105 0.64
106 0.74
107 0.82
108 0.87
109 0.87
110 0.88
111 0.9
112 0.9
113 0.91