Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MWR3

Protein Details
Accession A0A4S2MWR3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-98AKRGKAFKVRRHRKASNAMVFHydrophilic
100-119GVRKRKSVGKAMAKKRNATKBasic
NLS Segment(s)
PositionSequence
78-119AKRGKAFKVRRHRKASNAMVFAGVRKRKSVGKAMAKKRNATK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASRIKRNNAALRDTVHKPVEEARLARLSEKLLEVAKSDEKAPIVVRKTEKEAEDGDKMEVEQTTSGASSAAAKRGKAFKVRRHRKASNAMVFAGVRKRKSVGKAMAKKRNATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.63
4 0.56
5 0.53
6 0.49
7 0.45
8 0.39
9 0.34
10 0.3
11 0.32
12 0.34
13 0.32
14 0.3
15 0.27
16 0.3
17 0.3
18 0.3
19 0.26
20 0.21
21 0.19
22 0.19
23 0.17
24 0.13
25 0.13
26 0.13
27 0.15
28 0.15
29 0.15
30 0.15
31 0.14
32 0.13
33 0.14
34 0.15
35 0.17
36 0.17
37 0.21
38 0.23
39 0.24
40 0.28
41 0.3
42 0.29
43 0.26
44 0.26
45 0.24
46 0.24
47 0.23
48 0.18
49 0.15
50 0.14
51 0.13
52 0.1
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.08
62 0.09
63 0.15
64 0.16
65 0.16
66 0.19
67 0.25
68 0.28
69 0.34
70 0.41
71 0.45
72 0.55
73 0.66
74 0.73
75 0.77
76 0.79
77 0.78
78 0.81
79 0.81
80 0.78
81 0.7
82 0.61
83 0.53
84 0.48
85 0.42
86 0.41
87 0.35
88 0.28
89 0.28
90 0.3
91 0.34
92 0.39
93 0.46
94 0.47
95 0.54
96 0.63
97 0.71
98 0.78
99 0.78