Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MWK4

Protein Details
Accession A0A4S2MWK4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-103QPQENRHCDHSRQRRPLRPRSBasic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 9, E.R. 3
Family & Domain DBs
Amino Acid Sequences MKFSLLAVAAFVAGVAAQSASLARMFPIVIFKSAIDVDMLSSASPTNSVGCEPHGDHWHCTGYVSSSLPAPFSSRILLTTFLQPQENRHCDHSRQRRPLRPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.03
6 0.03
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.11
15 0.11
16 0.12
17 0.13
18 0.12
19 0.14
20 0.14
21 0.14
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.08
39 0.09
40 0.11
41 0.17
42 0.18
43 0.19
44 0.2
45 0.21
46 0.19
47 0.19
48 0.16
49 0.12
50 0.13
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.11
59 0.12
60 0.13
61 0.11
62 0.13
63 0.14
64 0.16
65 0.15
66 0.19
67 0.21
68 0.21
69 0.25
70 0.24
71 0.29
72 0.37
73 0.39
74 0.37
75 0.41
76 0.44
77 0.47
78 0.58
79 0.63
80 0.63
81 0.71
82 0.78
83 0.82