Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MJA6

Protein Details
Accession A0A4S2MJA6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
78-110KDDFQKKDHKKEEKDKNDNKKDHKKDHKREGFVBasic
145-171RPDDNEKKEKKEKKEKKEEEEKKLQSYBasic
NLS Segment(s)
PositionSequence
83-108KKDHKKEEKDKNDNKKDHKKDHKREG
122-164GKEGKEGKKGFERGYKAGAKLEIRPDDNEKKEKKEKKEKKEEE
Subcellular Location(s) extr 9, E.R. 8, golg 5, cyto 2, mito 1, cyto_nucl 1, cysk 1, vacu 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MQLLPLLPLLPVLVLSLPTDSATQKAPARAITGLHYTPPPFNLPYVTYDNYNHADHCTRPDCQTLYGPNAKNSIHFGKDDFQKKDHKKEEKDKNDNKKDHKKDHKREGFVISEKAGWEWDLGKEGKEGKKGFERGYKAGAKLEIRPDDNEKKEKKEKKEKKEEEEKKLQSYGYAYERPIHQEQKQENWYCPECHKHEYSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.08
5 0.09
6 0.1
7 0.1
8 0.11
9 0.13
10 0.17
11 0.2
12 0.22
13 0.23
14 0.23
15 0.26
16 0.25
17 0.24
18 0.23
19 0.25
20 0.22
21 0.22
22 0.23
23 0.22
24 0.22
25 0.23
26 0.23
27 0.19
28 0.19
29 0.19
30 0.19
31 0.22
32 0.26
33 0.26
34 0.25
35 0.25
36 0.28
37 0.29
38 0.28
39 0.24
40 0.22
41 0.22
42 0.21
43 0.26
44 0.25
45 0.23
46 0.25
47 0.29
48 0.27
49 0.27
50 0.3
51 0.27
52 0.3
53 0.35
54 0.35
55 0.33
56 0.34
57 0.32
58 0.29
59 0.3
60 0.28
61 0.22
62 0.21
63 0.2
64 0.23
65 0.31
66 0.37
67 0.35
68 0.34
69 0.42
70 0.47
71 0.55
72 0.58
73 0.6
74 0.61
75 0.69
76 0.77
77 0.78
78 0.83
79 0.83
80 0.85
81 0.85
82 0.83
83 0.82
84 0.82
85 0.79
86 0.79
87 0.81
88 0.81
89 0.81
90 0.86
91 0.84
92 0.77
93 0.72
94 0.66
95 0.59
96 0.5
97 0.42
98 0.31
99 0.24
100 0.21
101 0.18
102 0.14
103 0.09
104 0.08
105 0.07
106 0.07
107 0.1
108 0.1
109 0.1
110 0.12
111 0.17
112 0.19
113 0.25
114 0.25
115 0.25
116 0.32
117 0.35
118 0.37
119 0.39
120 0.4
121 0.36
122 0.42
123 0.42
124 0.35
125 0.34
126 0.34
127 0.29
128 0.28
129 0.33
130 0.31
131 0.3
132 0.31
133 0.37
134 0.41
135 0.46
136 0.51
137 0.48
138 0.52
139 0.6
140 0.66
141 0.69
142 0.73
143 0.77
144 0.8
145 0.87
146 0.88
147 0.88
148 0.91
149 0.9
150 0.88
151 0.88
152 0.81
153 0.74
154 0.67
155 0.57
156 0.47
157 0.4
158 0.36
159 0.31
160 0.3
161 0.27
162 0.29
163 0.31
164 0.35
165 0.39
166 0.41
167 0.38
168 0.44
169 0.48
170 0.54
171 0.61
172 0.58
173 0.56
174 0.58
175 0.57
176 0.52
177 0.53
178 0.52
179 0.48
180 0.52
181 0.51