Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N7W6

Protein Details
Accession A0A4S2N7W6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
351-371NVTFRRDKNTFRPRINKLDSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 8.5, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003439  ABC_transporter-like_ATP-bd  
IPR027417  P-loop_NTPase  
IPR013283  RLI1  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF00005  ABC_tran  
PROSITE View protein in PROSITE  
PS50893  ABC_TRANSPORTER_2  
Amino Acid Sequences MLSNCLVVSFSDSLSPLHAFKRRTYMFDEPSSYLDVKQRLKAANTIRGLLRPDDYVIVVEHDLSVLDYLSDFICVLYGKPSVYGVVTLPASVREGINIFLDGHIPTENLRFREESLQFRIAEAGDEFVNERMRSFTYPKMTKTMGKFSLTIDAGDFTDSEIVVMMGENGTGKTTFCRLLAGAEQPDPGSKKVPKLSISMKPQKINPKFPGTVRQLFLKKIKAAFLNPQFQTDVYKPLRIDDFIDQEVKHLSGGELQRVAITLALGIPADIYLIDEPSAYLDSEQRIIAARVIKRFIMHAKKTAFIVEHDFIMATYLADRVIVFEGTPSVKATATKPQSLLTGCNQFLKGLNVTFRRDKNTFRPRINKLDSQMDQEQKMSGNYFFLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.16
4 0.22
5 0.27
6 0.28
7 0.32
8 0.42
9 0.42
10 0.44
11 0.49
12 0.52
13 0.52
14 0.56
15 0.57
16 0.48
17 0.47
18 0.47
19 0.41
20 0.34
21 0.33
22 0.35
23 0.34
24 0.37
25 0.41
26 0.41
27 0.43
28 0.48
29 0.49
30 0.51
31 0.49
32 0.47
33 0.43
34 0.42
35 0.42
36 0.37
37 0.31
38 0.24
39 0.23
40 0.21
41 0.19
42 0.17
43 0.15
44 0.15
45 0.13
46 0.12
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.05
53 0.05
54 0.04
55 0.05
56 0.05
57 0.06
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.09
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.11
71 0.09
72 0.11
73 0.11
74 0.1
75 0.1
76 0.1
77 0.11
78 0.11
79 0.1
80 0.08
81 0.09
82 0.1
83 0.11
84 0.11
85 0.1
86 0.09
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.14
94 0.17
95 0.18
96 0.2
97 0.2
98 0.21
99 0.3
100 0.33
101 0.32
102 0.34
103 0.37
104 0.35
105 0.34
106 0.33
107 0.24
108 0.22
109 0.16
110 0.12
111 0.08
112 0.08
113 0.08
114 0.09
115 0.12
116 0.11
117 0.11
118 0.11
119 0.13
120 0.16
121 0.19
122 0.22
123 0.28
124 0.32
125 0.34
126 0.37
127 0.37
128 0.4
129 0.41
130 0.43
131 0.38
132 0.36
133 0.35
134 0.32
135 0.36
136 0.3
137 0.26
138 0.18
139 0.15
140 0.14
141 0.13
142 0.12
143 0.06
144 0.06
145 0.06
146 0.05
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.04
157 0.04
158 0.04
159 0.05
160 0.07
161 0.08
162 0.08
163 0.09
164 0.09
165 0.1
166 0.12
167 0.14
168 0.13
169 0.13
170 0.13
171 0.12
172 0.13
173 0.13
174 0.12
175 0.14
176 0.15
177 0.19
178 0.23
179 0.27
180 0.27
181 0.3
182 0.35
183 0.37
184 0.45
185 0.49
186 0.5
187 0.48
188 0.51
189 0.57
190 0.57
191 0.57
192 0.53
193 0.51
194 0.48
195 0.48
196 0.52
197 0.48
198 0.47
199 0.4
200 0.42
201 0.37
202 0.39
203 0.41
204 0.37
205 0.33
206 0.3
207 0.32
208 0.28
209 0.28
210 0.33
211 0.35
212 0.38
213 0.36
214 0.36
215 0.33
216 0.31
217 0.33
218 0.25
219 0.27
220 0.21
221 0.24
222 0.23
223 0.25
224 0.26
225 0.22
226 0.24
227 0.19
228 0.21
229 0.19
230 0.22
231 0.19
232 0.19
233 0.19
234 0.16
235 0.13
236 0.1
237 0.08
238 0.12
239 0.13
240 0.14
241 0.14
242 0.14
243 0.14
244 0.14
245 0.14
246 0.08
247 0.07
248 0.05
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.03
255 0.03
256 0.03
257 0.04
258 0.04
259 0.05
260 0.05
261 0.05
262 0.05
263 0.06
264 0.07
265 0.06
266 0.07
267 0.08
268 0.1
269 0.11
270 0.11
271 0.1
272 0.11
273 0.12
274 0.14
275 0.18
276 0.21
277 0.23
278 0.25
279 0.25
280 0.24
281 0.27
282 0.33
283 0.37
284 0.37
285 0.41
286 0.41
287 0.42
288 0.42
289 0.42
290 0.34
291 0.26
292 0.29
293 0.23
294 0.21
295 0.19
296 0.19
297 0.16
298 0.16
299 0.14
300 0.07
301 0.07
302 0.06
303 0.06
304 0.06
305 0.06
306 0.07
307 0.08
308 0.08
309 0.07
310 0.08
311 0.1
312 0.11
313 0.12
314 0.12
315 0.11
316 0.12
317 0.14
318 0.17
319 0.24
320 0.29
321 0.32
322 0.32
323 0.32
324 0.35
325 0.35
326 0.36
327 0.33
328 0.35
329 0.33
330 0.36
331 0.35
332 0.31
333 0.32
334 0.32
335 0.28
336 0.24
337 0.3
338 0.31
339 0.37
340 0.44
341 0.46
342 0.49
343 0.5
344 0.54
345 0.58
346 0.64
347 0.67
348 0.69
349 0.75
350 0.75
351 0.82
352 0.82
353 0.78
354 0.73
355 0.74
356 0.66
357 0.64
358 0.65
359 0.59
360 0.54
361 0.47
362 0.43
363 0.35
364 0.35
365 0.3
366 0.23
367 0.19