Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DR40

Protein Details
Accession A5DR40    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
189-217IDPRTLNRAERKKLVKKNELQHKRNLQGRHydrophilic
NLS Segment(s)
PositionSequence
117-143EKPIPKPKPPTKWEQFAAKKGIKAKAK
199-205RKKLVKK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.333, cyto 6, cyto_pero 4.833, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG pgu:PGUG_05741  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSSRTRCDWDFSSHRIEYKIMSEPEYKPVHVDQPIPTTFDLGNLAAFDPNPLDNEQLKTNKEQYLQSVTRDNVQLLVNQILSLPMKTTTDTHGSSTGQDSTMTLAQLPEPTTMLPREKPIPKPKPPTKWEQFAAKKGIKAKAKDGKMVYDEATGQWVPKWGYKGKNKELDDQWLVEVEDEPKNQGDELIDPRTLNRAERKKLVKKNELQHKRNLQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.41
4 0.34
5 0.32
6 0.35
7 0.29
8 0.3
9 0.33
10 0.32
11 0.39
12 0.4
13 0.36
14 0.31
15 0.32
16 0.34
17 0.32
18 0.34
19 0.3
20 0.34
21 0.35
22 0.34
23 0.31
24 0.28
25 0.24
26 0.22
27 0.2
28 0.13
29 0.13
30 0.11
31 0.12
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.1
38 0.1
39 0.13
40 0.14
41 0.17
42 0.22
43 0.25
44 0.26
45 0.29
46 0.32
47 0.33
48 0.33
49 0.32
50 0.3
51 0.35
52 0.35
53 0.33
54 0.34
55 0.31
56 0.31
57 0.31
58 0.27
59 0.21
60 0.19
61 0.18
62 0.15
63 0.16
64 0.12
65 0.11
66 0.11
67 0.1
68 0.1
69 0.08
70 0.07
71 0.07
72 0.07
73 0.08
74 0.09
75 0.11
76 0.15
77 0.16
78 0.16
79 0.18
80 0.17
81 0.17
82 0.18
83 0.16
84 0.12
85 0.11
86 0.09
87 0.09
88 0.1
89 0.09
90 0.07
91 0.07
92 0.07
93 0.08
94 0.09
95 0.07
96 0.07
97 0.07
98 0.08
99 0.1
100 0.12
101 0.11
102 0.13
103 0.19
104 0.23
105 0.31
106 0.4
107 0.48
108 0.54
109 0.64
110 0.7
111 0.73
112 0.73
113 0.75
114 0.7
115 0.68
116 0.63
117 0.62
118 0.59
119 0.55
120 0.58
121 0.5
122 0.47
123 0.46
124 0.5
125 0.45
126 0.42
127 0.47
128 0.47
129 0.47
130 0.5
131 0.46
132 0.43
133 0.39
134 0.39
135 0.3
136 0.23
137 0.21
138 0.16
139 0.17
140 0.14
141 0.12
142 0.11
143 0.13
144 0.13
145 0.16
146 0.2
147 0.23
148 0.32
149 0.41
150 0.5
151 0.55
152 0.63
153 0.63
154 0.67
155 0.64
156 0.63
157 0.57
158 0.48
159 0.4
160 0.32
161 0.29
162 0.22
163 0.2
164 0.15
165 0.16
166 0.15
167 0.16
168 0.16
169 0.16
170 0.16
171 0.16
172 0.14
173 0.14
174 0.19
175 0.21
176 0.21
177 0.21
178 0.22
179 0.27
180 0.27
181 0.28
182 0.33
183 0.39
184 0.45
185 0.54
186 0.63
187 0.68
188 0.76
189 0.81
190 0.81
191 0.81
192 0.84
193 0.87
194 0.87
195 0.82
196 0.83
197 0.82