FuNGI

A5DR22

Protein Details

Accession

A5DR22

Localization Confidence

Medium

Confidence Score

13.7

NoLS Segment(s)

Position	Sequence	Protein Nature
236-255	KTPVQRAPKNQRKLKRKLVI	Hydrophilic

NLS Segment(s)

Position	Sequence
243-251	PKNQRKLKR

Subcellular Location(s)

nucl 22, cyto_nucl 13.5, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR039781 Rad21/Rec8-like IPR006909 Rad21/Rec8_C_eu IPR006910 Rad21_Rec8_N IPR023093 ScpA-like_C IPR036390 WH_DNA-bd_sf
Gene Ontology	GO:0008278 C:cohesin complex GO:0005634 C:nucleus GO:0007062 P:sister chromatid cohesion
KEGG	pgu:PGUG_05723 -
Pfam	View protein in Pfam PF04824 Rad21_Rec8 PF04825 Rad21_Rec8_N

Amino Acid Sequences

MTDIVSRQSPLAPVWLAANYDKKLTKHQLLSANIVHSSSLITHNETPGTINLRLSGQLLLGIVRIYSRKTKYLLDDVNDILFKLKNSFRYATGVSSDAIQVTAAPQNQVITNISSITLQDQVTDLNLLYQEDLRLDDEVPTTLFRNLNSALPDDTMDTSIEYGRNADIHEPDNNDVDLELDFNLDQSIEMGRNAPGVNAAGDMSLMDLHDDLNFDIGEPLQTLDAESIHEEVPPPKTPVQRAPKNQRKLKRKLVIDSPQELERGISIHELKRLSQLRLRDLTVHSFDFHLSEQDKLNLIQELSTNKRRRFALDSQLQEVCEELAMQEEQHKEQQEEEEPNFEFGNLDLDLSLPEIEFPQEPISSNAQSSMQIANLLREKFDEKDTVEFSDVVHEDMKSQKPLGMKEENKINKRREASKCFFEVLVLATNNCISVNSDLTITKKESIYTKFL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.19
2	0.19
3	0.2
4	0.22
5	0.27
6	0.24
7	0.29
8	0.33
9	0.33
10	0.4
11	0.47
12	0.52
13	0.51
14	0.57
15	0.59
16	0.59
17	0.63
18	0.57
19	0.51
20	0.43
21	0.37
22	0.3
23	0.22
24	0.19
25	0.15
26	0.16
27	0.15
28	0.19
29	0.21
30	0.23
31	0.24
32	0.23
33	0.23
34	0.22
35	0.25
36	0.22
37	0.21
38	0.2
39	0.21
40	0.21
41	0.2
42	0.17
43	0.12
44	0.11
45	0.11
46	0.1
47	0.09
48	0.08
49	0.07
50	0.08
51	0.09
52	0.11
53	0.19
54	0.23
55	0.27
56	0.3
57	0.35
58	0.39
59	0.47
60	0.5
61	0.45
62	0.45
63	0.42
64	0.42
65	0.37
66	0.31
67	0.23
68	0.18
69	0.16
70	0.18
71	0.2
72	0.23
73	0.28
74	0.3
75	0.31
76	0.34
77	0.35
78	0.32
79	0.31
80	0.26
81	0.21
82	0.2
83	0.18
84	0.13
85	0.12
86	0.09
87	0.07
88	0.08
89	0.11
90	0.11
91	0.11
92	0.11
93	0.12
94	0.13
95	0.15
96	0.14
97	0.12
98	0.12
99	0.11
100	0.11
101	0.11
102	0.1
103	0.1
104	0.12
105	0.1
106	0.1
107	0.1
108	0.1
109	0.1
110	0.11
111	0.09
112	0.07
113	0.07
114	0.07
115	0.08
116	0.08
117	0.08
118	0.08
119	0.09
120	0.09
121	0.09
122	0.09
123	0.1
124	0.1
125	0.1
126	0.1
127	0.1
128	0.11
129	0.13
130	0.13
131	0.12
132	0.15
133	0.16
134	0.18
135	0.18
136	0.18
137	0.16
138	0.15
139	0.16
140	0.13
141	0.13
142	0.11
143	0.1
144	0.09
145	0.09
146	0.09
147	0.09
148	0.08
149	0.08
150	0.08
151	0.08
152	0.09
153	0.1
154	0.11
155	0.12
156	0.15
157	0.16
158	0.17
159	0.18
160	0.17
161	0.15
162	0.12
163	0.11
164	0.09
165	0.07
166	0.06
167	0.05
168	0.05
169	0.05
170	0.05
171	0.04
172	0.04
173	0.04
174	0.05
175	0.05
176	0.05
177	0.06
178	0.06
179	0.08
180	0.08
181	0.07
182	0.07
183	0.07
184	0.07
185	0.06
186	0.06
187	0.05
188	0.04
189	0.04
190	0.04
191	0.04
192	0.03
193	0.03
194	0.03
195	0.03
196	0.04
197	0.04
198	0.04
199	0.05
200	0.05
201	0.05
202	0.05
203	0.05
204	0.05
205	0.04
206	0.05
207	0.04
208	0.04
209	0.04
210	0.04
211	0.04
212	0.04
213	0.05
214	0.06
215	0.06
216	0.06
217	0.07
218	0.08
219	0.11
220	0.12
221	0.15
222	0.17
223	0.2
224	0.23
225	0.32
226	0.4
227	0.45
228	0.53
229	0.62
230	0.68
231	0.75
232	0.79
233	0.79
234	0.79
235	0.8
236	0.81
237	0.78
238	0.73
239	0.69
240	0.71
241	0.7
242	0.65
243	0.6
244	0.51
245	0.44
246	0.39
247	0.34
248	0.24
249	0.16
250	0.11
251	0.08
252	0.09
253	0.1
254	0.12
255	0.16
256	0.16
257	0.16
258	0.24
259	0.27
260	0.27
261	0.27
262	0.3
263	0.32
264	0.34
265	0.35
266	0.3
267	0.29
268	0.31
269	0.3
270	0.27
271	0.22
272	0.2
273	0.19
274	0.17
275	0.15
276	0.14
277	0.12
278	0.13
279	0.14
280	0.14
281	0.15
282	0.14
283	0.15
284	0.13
285	0.12
286	0.11
287	0.12
288	0.16
289	0.21
290	0.3
291	0.36
292	0.37
293	0.42
294	0.43
295	0.45
296	0.47
297	0.48
298	0.49
299	0.5
300	0.51
301	0.5
302	0.5
303	0.45
304	0.38
305	0.31
306	0.21
307	0.13
308	0.09
309	0.05
310	0.06
311	0.06
312	0.06
313	0.11
314	0.12
315	0.14
316	0.18
317	0.2
318	0.19
319	0.2
320	0.24
321	0.25
322	0.29
323	0.28
324	0.28
325	0.27
326	0.27
327	0.26
328	0.22
329	0.17
330	0.11
331	0.13
332	0.09
333	0.09
334	0.07
335	0.08
336	0.08
337	0.08
338	0.08
339	0.05
340	0.05
341	0.06
342	0.07
343	0.08
344	0.09
345	0.11
346	0.11
347	0.13
348	0.16
349	0.2
350	0.2
351	0.19
352	0.19
353	0.18
354	0.18
355	0.19
356	0.16
357	0.12
358	0.15
359	0.15
360	0.18
361	0.23
362	0.22
363	0.21
364	0.22
365	0.24
366	0.23
367	0.26
368	0.26
369	0.22
370	0.27
371	0.29
372	0.29
373	0.28
374	0.26
375	0.23
376	0.25
377	0.24
378	0.2
379	0.19
380	0.16
381	0.17
382	0.23
383	0.27
384	0.23
385	0.24
386	0.25
387	0.28
388	0.32
389	0.37
390	0.41
391	0.4
392	0.43
393	0.53
394	0.59
395	0.63
396	0.68
397	0.67
398	0.65
399	0.69
400	0.73
401	0.73
402	0.74
403	0.73
404	0.73
405	0.7
406	0.64
407	0.57
408	0.48
409	0.39
410	0.31
411	0.29
412	0.22
413	0.19
414	0.17
415	0.17
416	0.17
417	0.16
418	0.14
419	0.1
420	0.12
421	0.15
422	0.14
423	0.16
424	0.18
425	0.2
426	0.24
427	0.25
428	0.26
429	0.25
430	0.27
431	0.32

A5DR22

3D AlphaFold-predicted Structure Viewer