Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MLY1

Protein Details
Accession A0A4S2MLY1   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-123GLQHPHARHRRRRSHPLPPRLRPHRBasic
141-170YSLPARPHKAPTKRRYGRRHRPRLHPSAAYBasic
NLS Segment(s)
PositionSequence
104-164HARHRRRRSHPLPPRLRPHRTFPRRPHQGLPPHPRSPYSLPARPHKAPTKRRYGRRHRPRL
Subcellular Location(s) mito 15, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041694  ADH_N_2  
IPR011032  GroES-like_sf  
Pfam View protein in Pfam  
PF16884  ADH_N_2  
Amino Acid Sequences MSDLSTLRSLPDIPRSNCNPHRIIMSATQTYEIKEWRLKQLPQGEINPYEDFELVTKTFEGPLEEGHVLVELVGLSNDPAQRTWLVDKPASEHYMSPVGLQHPHARHRRRRSHPLPPRLRPHRTFPRRPHQGLPPHPRSPYSLPARPHKAPTKRRYGRRHRPRLHPSAAYAGLLGTGEATSTDNVIVVSGAAGATGSTVVQIAKNVLGVKHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.57
4 0.61
5 0.65
6 0.57
7 0.5
8 0.5
9 0.44
10 0.42
11 0.38
12 0.38
13 0.34
14 0.32
15 0.33
16 0.3
17 0.29
18 0.29
19 0.24
20 0.22
21 0.25
22 0.28
23 0.34
24 0.41
25 0.41
26 0.46
27 0.52
28 0.53
29 0.52
30 0.53
31 0.48
32 0.43
33 0.45
34 0.38
35 0.3
36 0.25
37 0.2
38 0.17
39 0.13
40 0.14
41 0.1
42 0.11
43 0.11
44 0.1
45 0.11
46 0.11
47 0.12
48 0.1
49 0.1
50 0.13
51 0.13
52 0.12
53 0.11
54 0.11
55 0.09
56 0.08
57 0.07
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.06
64 0.07
65 0.07
66 0.07
67 0.09
68 0.09
69 0.11
70 0.15
71 0.16
72 0.18
73 0.19
74 0.19
75 0.21
76 0.24
77 0.24
78 0.21
79 0.17
80 0.16
81 0.18
82 0.18
83 0.15
84 0.13
85 0.12
86 0.13
87 0.14
88 0.18
89 0.18
90 0.25
91 0.33
92 0.4
93 0.48
94 0.57
95 0.66
96 0.69
97 0.77
98 0.77
99 0.8
100 0.82
101 0.84
102 0.83
103 0.8
104 0.82
105 0.79
106 0.8
107 0.72
108 0.71
109 0.72
110 0.72
111 0.74
112 0.73
113 0.75
114 0.77
115 0.77
116 0.73
117 0.7
118 0.7
119 0.7
120 0.71
121 0.68
122 0.63
123 0.6
124 0.56
125 0.53
126 0.48
127 0.47
128 0.45
129 0.42
130 0.43
131 0.51
132 0.57
133 0.54
134 0.57
135 0.57
136 0.6
137 0.65
138 0.68
139 0.71
140 0.73
141 0.81
142 0.84
143 0.86
144 0.87
145 0.88
146 0.92
147 0.89
148 0.91
149 0.91
150 0.89
151 0.85
152 0.76
153 0.68
154 0.63
155 0.55
156 0.44
157 0.34
158 0.25
159 0.18
160 0.15
161 0.12
162 0.05
163 0.04
164 0.04
165 0.04
166 0.06
167 0.05
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.04
183 0.03
184 0.03
185 0.04
186 0.05
187 0.06
188 0.07
189 0.09
190 0.09
191 0.12
192 0.14