Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MNB6

Protein Details
Accession A0A4S2MNB6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTWRYKDYTTPPRAKKNKEPSPPPDPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 8, mito 7, pero 2, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MTWRYKDYTTPPRAKKNKEPSPPPDPEPTKPKIVLTALPALIAAPSSLLVVTQLAHPARPTRSRTASRTFFQSRRAVIHIRTTHLPILQRQQLHHPTEGPQQLPEALQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.84
5 0.84
6 0.85
7 0.81
8 0.81
9 0.78
10 0.71
11 0.7
12 0.65
13 0.61
14 0.59
15 0.55
16 0.51
17 0.47
18 0.44
19 0.38
20 0.35
21 0.31
22 0.27
23 0.28
24 0.22
25 0.21
26 0.2
27 0.16
28 0.13
29 0.11
30 0.07
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.07
41 0.07
42 0.07
43 0.08
44 0.11
45 0.14
46 0.2
47 0.23
48 0.27
49 0.34
50 0.39
51 0.44
52 0.5
53 0.51
54 0.48
55 0.52
56 0.52
57 0.47
58 0.48
59 0.48
60 0.41
61 0.39
62 0.42
63 0.37
64 0.33
65 0.4
66 0.36
67 0.35
68 0.36
69 0.35
70 0.33
71 0.33
72 0.33
73 0.28
74 0.34
75 0.35
76 0.35
77 0.35
78 0.42
79 0.47
80 0.48
81 0.47
82 0.4
83 0.39
84 0.45
85 0.49
86 0.4
87 0.33
88 0.31