Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SHN9

Protein Details
Accession A0A4V3SHN9   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
283-305GDRFSERRERERREEQGREKEVSBasic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.833, mito 9.5, cyto 9, nucl 7, cyto_pero 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR014063  Arsenate-R_ArsH  
IPR029039  Flavoprotein-like_sf  
IPR005025  FMN_Rdtase-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF03358  FMN_red  
Amino Acid Sequences MSTTTPATSPIQGDLNNTSSVRVTKIPPIDSSYATTTLAIPASSDDPHIRSVYRPFLLPADSACSKHDWVASLELSTVLQLSSADIAKNGRIKVLVLYGSLRERSYSRFLAFEMSRLLWRLGCDVRVYDPRGLPVKDDVNHGHPKVVELRELSKWSDGHVWVSPEQHGNLTAVFKNQIDWIPLSIGSVRPTQGRTLSILQVSGGSQSFNAVNSLRILGRWMRMFTIPNQSSVPQAWTQFYEADSGEGLNGRMKPGSLRERVVDCAEEFVKYTILMRPNWEVFGDRFSERRERERREEQGREKEVSEAELRAKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.26
5 0.24
6 0.22
7 0.23
8 0.23
9 0.22
10 0.22
11 0.27
12 0.33
13 0.34
14 0.35
15 0.39
16 0.39
17 0.37
18 0.39
19 0.34
20 0.3
21 0.28
22 0.26
23 0.21
24 0.19
25 0.18
26 0.14
27 0.1
28 0.11
29 0.12
30 0.12
31 0.14
32 0.15
33 0.16
34 0.19
35 0.2
36 0.19
37 0.2
38 0.25
39 0.3
40 0.29
41 0.28
42 0.27
43 0.28
44 0.28
45 0.26
46 0.21
47 0.2
48 0.21
49 0.21
50 0.21
51 0.22
52 0.21
53 0.22
54 0.23
55 0.18
56 0.18
57 0.21
58 0.2
59 0.17
60 0.17
61 0.15
62 0.13
63 0.11
64 0.09
65 0.05
66 0.05
67 0.04
68 0.05
69 0.06
70 0.07
71 0.07
72 0.08
73 0.09
74 0.12
75 0.16
76 0.16
77 0.15
78 0.15
79 0.15
80 0.16
81 0.18
82 0.15
83 0.12
84 0.13
85 0.14
86 0.16
87 0.17
88 0.15
89 0.14
90 0.14
91 0.17
92 0.22
93 0.23
94 0.21
95 0.21
96 0.21
97 0.26
98 0.24
99 0.22
100 0.19
101 0.17
102 0.16
103 0.17
104 0.17
105 0.12
106 0.12
107 0.15
108 0.13
109 0.13
110 0.13
111 0.13
112 0.16
113 0.2
114 0.22
115 0.21
116 0.21
117 0.23
118 0.27
119 0.26
120 0.24
121 0.23
122 0.24
123 0.22
124 0.25
125 0.24
126 0.25
127 0.3
128 0.29
129 0.27
130 0.22
131 0.22
132 0.25
133 0.23
134 0.2
135 0.16
136 0.19
137 0.19
138 0.21
139 0.2
140 0.17
141 0.17
142 0.16
143 0.18
144 0.15
145 0.15
146 0.15
147 0.16
148 0.15
149 0.16
150 0.15
151 0.14
152 0.14
153 0.12
154 0.11
155 0.1
156 0.09
157 0.1
158 0.09
159 0.09
160 0.1
161 0.09
162 0.1
163 0.11
164 0.11
165 0.11
166 0.11
167 0.11
168 0.1
169 0.1
170 0.1
171 0.09
172 0.1
173 0.1
174 0.11
175 0.11
176 0.12
177 0.13
178 0.14
179 0.15
180 0.15
181 0.17
182 0.18
183 0.2
184 0.18
185 0.17
186 0.16
187 0.14
188 0.13
189 0.11
190 0.08
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.09
197 0.08
198 0.08
199 0.09
200 0.11
201 0.09
202 0.09
203 0.11
204 0.12
205 0.15
206 0.17
207 0.17
208 0.17
209 0.19
210 0.21
211 0.22
212 0.31
213 0.28
214 0.28
215 0.29
216 0.27
217 0.28
218 0.27
219 0.27
220 0.18
221 0.19
222 0.18
223 0.18
224 0.2
225 0.18
226 0.18
227 0.16
228 0.14
229 0.13
230 0.12
231 0.1
232 0.09
233 0.09
234 0.09
235 0.1
236 0.11
237 0.11
238 0.11
239 0.12
240 0.14
241 0.21
242 0.29
243 0.3
244 0.32
245 0.35
246 0.38
247 0.41
248 0.4
249 0.35
250 0.26
251 0.26
252 0.24
253 0.21
254 0.19
255 0.17
256 0.15
257 0.13
258 0.14
259 0.15
260 0.19
261 0.2
262 0.23
263 0.28
264 0.29
265 0.3
266 0.29
267 0.27
268 0.24
269 0.26
270 0.26
271 0.22
272 0.23
273 0.26
274 0.35
275 0.36
276 0.45
277 0.51
278 0.56
279 0.64
280 0.71
281 0.77
282 0.77
283 0.84
284 0.83
285 0.84
286 0.8
287 0.74
288 0.65
289 0.59
290 0.5
291 0.44
292 0.37
293 0.29
294 0.31