Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2N3E4

Protein Details
Accession A0A4S2N3E4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-22GKRKKSSRKPMGPKKKEPLQTTBasic
NLS Segment(s)
PositionSequence
2-16KRKKSSRKPMGPKKK
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences GKRKKSSRKPMGPKKKEPLQTTFNCLFCNHEDAVTCKLDKKAGIGSLQCKSCGQRFQANINYLSHAVDVYSEWVDACEEEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.86
4 0.8
5 0.75
6 0.72
7 0.66
8 0.63
9 0.59
10 0.51
11 0.44
12 0.39
13 0.35
14 0.28
15 0.29
16 0.21
17 0.17
18 0.17
19 0.18
20 0.21
21 0.19
22 0.17
23 0.15
24 0.16
25 0.16
26 0.15
27 0.15
28 0.14
29 0.15
30 0.17
31 0.17
32 0.2
33 0.22
34 0.23
35 0.22
36 0.2
37 0.21
38 0.23
39 0.26
40 0.26
41 0.29
42 0.31
43 0.38
44 0.44
45 0.45
46 0.43
47 0.39
48 0.38
49 0.31
50 0.28
51 0.21
52 0.14
53 0.11
54 0.09
55 0.08
56 0.09
57 0.09
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09