Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2ML31

Protein Details
Accession A0A4S2ML31    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-27DGERVCTRVNRQQKRQRRHGSWDGRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, cyto 3.5, mito 2
Family & Domain DBs
Amino Acid Sequences MDGERVCTRVNRQQKRQRRHGSWDGRLMGWKWAEKNHSGREKGCSNDDRRAAVSGVDTEQDSTIDESLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.89
4 0.9
5 0.86
6 0.85
7 0.85
8 0.84
9 0.79
10 0.77
11 0.68
12 0.57
13 0.53
14 0.44
15 0.37
16 0.29
17 0.25
18 0.19
19 0.2
20 0.22
21 0.24
22 0.28
23 0.32
24 0.37
25 0.38
26 0.38
27 0.4
28 0.41
29 0.39
30 0.4
31 0.39
32 0.37
33 0.42
34 0.43
35 0.39
36 0.37
37 0.37
38 0.31
39 0.25
40 0.22
41 0.16
42 0.15
43 0.14
44 0.13
45 0.12
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11