Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DFF0

Protein Details
Accession A5DFF0    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLRHSGSRKKKIRNCCCQVEQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5, cyto_nucl 4
Family & Domain DBs
KEGG pgu:PGUG_02001  -  
Amino Acid Sequences MLRHSGSRKKKIRNCCCQVEQGSAVQSAHYGGSRFQCVQILVHCGIWNEKKQIRLGRIFILAKHHQHFISKIRVYLNLVVDFGHIVQKAIGSMGIMARIWKKRILSMKKYYCVIIFQKIFGRSSSSGSCTEIVNESYCVIFKRNRSSSRSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.8
4 0.78
5 0.73
6 0.67
7 0.58
8 0.49
9 0.43
10 0.35
11 0.3
12 0.22
13 0.19
14 0.14
15 0.12
16 0.11
17 0.1
18 0.1
19 0.14
20 0.17
21 0.18
22 0.18
23 0.19
24 0.18
25 0.19
26 0.19
27 0.2
28 0.18
29 0.18
30 0.18
31 0.16
32 0.19
33 0.22
34 0.23
35 0.25
36 0.26
37 0.28
38 0.33
39 0.38
40 0.4
41 0.4
42 0.39
43 0.35
44 0.38
45 0.36
46 0.31
47 0.32
48 0.31
49 0.3
50 0.3
51 0.29
52 0.25
53 0.25
54 0.27
55 0.25
56 0.3
57 0.26
58 0.26
59 0.25
60 0.26
61 0.26
62 0.27
63 0.24
64 0.16
65 0.15
66 0.14
67 0.13
68 0.11
69 0.1
70 0.09
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.03
79 0.04
80 0.04
81 0.05
82 0.04
83 0.06
84 0.1
85 0.13
86 0.15
87 0.18
88 0.18
89 0.24
90 0.34
91 0.42
92 0.46
93 0.54
94 0.61
95 0.62
96 0.62
97 0.58
98 0.49
99 0.45
100 0.39
101 0.37
102 0.3
103 0.28
104 0.32
105 0.33
106 0.33
107 0.28
108 0.31
109 0.24
110 0.27
111 0.28
112 0.25
113 0.25
114 0.26
115 0.26
116 0.21
117 0.21
118 0.19
119 0.18
120 0.17
121 0.16
122 0.15
123 0.15
124 0.15
125 0.15
126 0.16
127 0.2
128 0.25
129 0.34
130 0.43
131 0.5