Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MZ22

Protein Details
Accession A0A4S2MZ22    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
116-140KIKALLAKLKSKKEKKDKTETAPEAHydrophilic
NLS Segment(s)
PositionSequence
104-133ATKPAKTGGLKAKIKALLAKLKSKKEKKDK
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MSETTPAVSHGRGGAGNIAPDDTQYVDGGIHREGDPAATGGAYSAGRGGAGNIGSPAQKPLTTGNDDDIIPENAKVQHHDDQVYHTGRGGEGNVELPKKEGEEATKPAKTGGLKAKIKALLAKLKSKKEKKDKTETAPEAAPETVDAPAETTTAEATTSDPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.15
5 0.15
6 0.13
7 0.13
8 0.13
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.1
15 0.11
16 0.11
17 0.12
18 0.11
19 0.11
20 0.11
21 0.11
22 0.1
23 0.09
24 0.09
25 0.06
26 0.06
27 0.05
28 0.07
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.09
44 0.08
45 0.08
46 0.09
47 0.12
48 0.16
49 0.18
50 0.19
51 0.18
52 0.19
53 0.19
54 0.19
55 0.18
56 0.15
57 0.12
58 0.12
59 0.12
60 0.12
61 0.12
62 0.13
63 0.15
64 0.19
65 0.2
66 0.21
67 0.2
68 0.21
69 0.26
70 0.26
71 0.21
72 0.17
73 0.16
74 0.14
75 0.15
76 0.12
77 0.07
78 0.06
79 0.08
80 0.09
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.1
88 0.12
89 0.15
90 0.2
91 0.25
92 0.26
93 0.25
94 0.25
95 0.27
96 0.24
97 0.25
98 0.29
99 0.34
100 0.35
101 0.36
102 0.41
103 0.4
104 0.4
105 0.37
106 0.34
107 0.32
108 0.34
109 0.43
110 0.44
111 0.52
112 0.61
113 0.66
114 0.72
115 0.75
116 0.81
117 0.81
118 0.85
119 0.85
120 0.83
121 0.86
122 0.79
123 0.72
124 0.63
125 0.55
126 0.46
127 0.37
128 0.29
129 0.18
130 0.16
131 0.12
132 0.11
133 0.1
134 0.09
135 0.09
136 0.09
137 0.08
138 0.07
139 0.08
140 0.07
141 0.08
142 0.07
143 0.08