Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SJA0

Protein Details
Accession A0A4V3SJA0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101TPVPRTWPIPHRKREPLNDGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MKQFRPPLHEPSFPYVDPQKIFGRPPPEPTRPNLFNNPIRYMRWAAITNPAPFWSVVIGVSAVPISVALLLYRHYTGWEDHTPVPRTWPIPHRKREPLNDGGIYDDPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.42
4 0.37
5 0.37
6 0.34
7 0.32
8 0.35
9 0.35
10 0.38
11 0.35
12 0.42
13 0.46
14 0.49
15 0.49
16 0.51
17 0.55
18 0.52
19 0.55
20 0.54
21 0.53
22 0.51
23 0.54
24 0.54
25 0.47
26 0.44
27 0.42
28 0.37
29 0.31
30 0.28
31 0.25
32 0.2
33 0.25
34 0.28
35 0.25
36 0.23
37 0.23
38 0.2
39 0.18
40 0.18
41 0.1
42 0.07
43 0.06
44 0.06
45 0.05
46 0.04
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.06
59 0.07
60 0.07
61 0.07
62 0.09
63 0.1
64 0.16
65 0.18
66 0.21
67 0.24
68 0.32
69 0.34
70 0.33
71 0.37
72 0.34
73 0.35
74 0.37
75 0.43
76 0.46
77 0.52
78 0.62
79 0.66
80 0.72
81 0.78
82 0.81
83 0.79
84 0.76
85 0.73
86 0.66
87 0.57
88 0.52