Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MTE0

Protein Details
Accession A0A4S2MTE0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-102SPPSLDPQKKEHRKKRQQRQRKIVTAPPHydrophilic
121-169INKNNVVKKKRETGKKRNLQKKKKPKKKKDKKNRKICKRGNKIDRQPPVBasic
NLS Segment(s)
PositionSequence
83-96KKEHRKKRQQRQRK
128-163KKKRETGKKRNLQKKKKPKKKKDKKNRKICKRGNKI
Subcellular Location(s) mito 11.5, mito_nucl 11.499, nucl 10, cyto_nucl 8.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGVRMGVRGELVGVAVVGIHHHHHYSLLTPTQHTQPGIMVHERISFHIVSFFFITPSHPLLAPSHPLLPFSPFSSPPSLDPQKKEHRKKRQQRQRKIVTAPPTTATTGLIYAQKTACYKEINKNNVVKKKRETGKKRNLQKKKKPKKKKDKKNRKICKRGNKIDRQPPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.07
7 0.09
8 0.1
9 0.1
10 0.11
11 0.12
12 0.14
13 0.18
14 0.21
15 0.21
16 0.23
17 0.25
18 0.28
19 0.31
20 0.28
21 0.24
22 0.21
23 0.22
24 0.24
25 0.23
26 0.2
27 0.18
28 0.21
29 0.21
30 0.2
31 0.2
32 0.16
33 0.15
34 0.18
35 0.17
36 0.15
37 0.17
38 0.15
39 0.13
40 0.13
41 0.15
42 0.13
43 0.14
44 0.14
45 0.11
46 0.12
47 0.14
48 0.16
49 0.17
50 0.16
51 0.17
52 0.16
53 0.17
54 0.17
55 0.17
56 0.16
57 0.15
58 0.17
59 0.14
60 0.17
61 0.19
62 0.19
63 0.18
64 0.25
65 0.3
66 0.3
67 0.32
68 0.37
69 0.45
70 0.55
71 0.63
72 0.65
73 0.7
74 0.78
75 0.86
76 0.9
77 0.91
78 0.92
79 0.92
80 0.93
81 0.91
82 0.88
83 0.82
84 0.77
85 0.74
86 0.66
87 0.56
88 0.47
89 0.39
90 0.32
91 0.27
92 0.22
93 0.14
94 0.12
95 0.12
96 0.12
97 0.11
98 0.12
99 0.12
100 0.14
101 0.14
102 0.15
103 0.16
104 0.18
105 0.22
106 0.3
107 0.39
108 0.42
109 0.47
110 0.53
111 0.59
112 0.64
113 0.66
114 0.63
115 0.6
116 0.65
117 0.67
118 0.71
119 0.73
120 0.75
121 0.8
122 0.83
123 0.88
124 0.89
125 0.91
126 0.92
127 0.93
128 0.93
129 0.93
130 0.95
131 0.96
132 0.96
133 0.97
134 0.97
135 0.97
136 0.97
137 0.97
138 0.97
139 0.97
140 0.97
141 0.97
142 0.97
143 0.96
144 0.95
145 0.95
146 0.95
147 0.95
148 0.94
149 0.94