Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MJP6

Protein Details
Accession A0A4S2MJP6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-79VVVRSSSSSPPRRRRRTSPHRPDRRLHydrophilic
NLS Segment(s)
PositionSequence
63-79PPRRRRRTSPHRPDRRL
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MLIVARYSSTLNVRKSTHRATHRAQGIETSYIPPSPLSALCSPSPRHPCASLLVVVRSSSSSPPRRRRRTSPHRPDRRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.52
4 0.53
5 0.54
6 0.57
7 0.57
8 0.63
9 0.62
10 0.57
11 0.49
12 0.43
13 0.37
14 0.33
15 0.29
16 0.22
17 0.16
18 0.15
19 0.15
20 0.12
21 0.1
22 0.09
23 0.09
24 0.11
25 0.11
26 0.14
27 0.14
28 0.18
29 0.19
30 0.25
31 0.3
32 0.29
33 0.3
34 0.29
35 0.29
36 0.29
37 0.3
38 0.26
39 0.22
40 0.21
41 0.2
42 0.18
43 0.17
44 0.15
45 0.14
46 0.15
47 0.22
48 0.31
49 0.4
50 0.51
51 0.62
52 0.71
53 0.78
54 0.84
55 0.87
56 0.89
57 0.9
58 0.91
59 0.91