Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P8V0

Protein Details
Accession Q9P8V0    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
225-259APPQRGVKGMFKKKQQRDPQAQSYKRVRKHRCVVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, mito 9, cyto_nucl 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005935  C:cellular bud neck  
GO:0005737  C:cytoplasm  
GO:0000131  C:incipient cellular bud site  
GO:0005886  C:plasma membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0030011  P:maintenance of cell polarity  
GO:0090338  P:positive regulation of formin-nucleated actin cable assembly  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG ago:AGOS_ACR257C  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51420  RHO  
Amino Acid Sequences MSAGPLQAAPKKNYGALIGAGPAVGGAAFNRTLSEVASYERSRRDHATPDYRIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNIEGPRGKVIELALWDTAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMMLVGLKSDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALYDELRAPPQRGVKGMFKKKQQRDPQAQSYKRVRKHRCVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.24
4 0.22
5 0.18
6 0.15
7 0.13
8 0.11
9 0.09
10 0.06
11 0.05
12 0.04
13 0.03
14 0.06
15 0.06
16 0.07
17 0.07
18 0.09
19 0.09
20 0.09
21 0.12
22 0.1
23 0.12
24 0.19
25 0.2
26 0.23
27 0.29
28 0.31
29 0.33
30 0.36
31 0.38
32 0.4
33 0.48
34 0.53
35 0.55
36 0.61
37 0.6
38 0.56
39 0.52
40 0.44
41 0.37
42 0.28
43 0.22
44 0.14
45 0.1
46 0.1
47 0.11
48 0.1
49 0.08
50 0.08
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.08
58 0.13
59 0.15
60 0.15
61 0.16
62 0.16
63 0.15
64 0.16
65 0.18
66 0.13
67 0.12
68 0.11
69 0.13
70 0.12
71 0.13
72 0.12
73 0.09
74 0.1
75 0.1
76 0.11
77 0.1
78 0.1
79 0.09
80 0.11
81 0.12
82 0.12
83 0.12
84 0.11
85 0.11
86 0.11
87 0.11
88 0.11
89 0.1
90 0.11
91 0.09
92 0.09
93 0.09
94 0.08
95 0.08
96 0.06
97 0.05
98 0.04
99 0.05
100 0.07
101 0.1
102 0.11
103 0.11
104 0.1
105 0.11
106 0.12
107 0.16
108 0.15
109 0.13
110 0.13
111 0.13
112 0.13
113 0.12
114 0.1
115 0.05
116 0.04
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.06
125 0.07
126 0.07
127 0.08
128 0.08
129 0.08
130 0.09
131 0.09
132 0.08
133 0.11
134 0.11
135 0.1
136 0.14
137 0.15
138 0.16
139 0.19
140 0.22
141 0.19
142 0.22
143 0.23
144 0.19
145 0.18
146 0.17
147 0.15
148 0.15
149 0.14
150 0.11
151 0.1
152 0.09
153 0.09
154 0.09
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.06
168 0.06
169 0.08
170 0.07
171 0.06
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.07
178 0.07
179 0.09
180 0.1
181 0.11
182 0.15
183 0.19
184 0.2
185 0.2
186 0.24
187 0.27
188 0.3
189 0.33
190 0.31
191 0.31
192 0.33
193 0.35
194 0.35
195 0.35
196 0.34
197 0.32
198 0.29
199 0.27
200 0.23
201 0.21
202 0.17
203 0.11
204 0.08
205 0.09
206 0.09
207 0.09
208 0.1
209 0.12
210 0.18
211 0.2
212 0.21
213 0.24
214 0.3
215 0.32
216 0.35
217 0.37
218 0.42
219 0.5
220 0.59
221 0.61
222 0.65
223 0.73
224 0.79
225 0.85
226 0.86
227 0.86
228 0.86
229 0.89
230 0.9
231 0.9
232 0.85
233 0.84
234 0.84
235 0.83
236 0.8
237 0.82
238 0.8
239 0.8