Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S2MJV6

Protein Details
Accession A0A4S2MJV6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-108QTRSTDKTLRNSTPKKKKKKNKKKQRKLQPSAQRHydrophilic
NLS Segment(s)
PositionSequence
87-105TPKKKKKKNKKKQRKLQPS
Subcellular Location(s) nucl 16, mito_nucl 13.499, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
Amino Acid Sequences MERKNMKLRRFGWLWSNAAPPPSRLLRSDSISQHAHTVPDSEQQSIQDNPQEQKTQQKISQNKNDTTFNIKKILQTRSTDKTLRNSTPKKKKKKNKKKQRKLQPSAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.44
4 0.37
5 0.38
6 0.35
7 0.28
8 0.27
9 0.28
10 0.27
11 0.25
12 0.29
13 0.3
14 0.33
15 0.38
16 0.35
17 0.36
18 0.35
19 0.34
20 0.32
21 0.28
22 0.24
23 0.18
24 0.18
25 0.14
26 0.18
27 0.19
28 0.17
29 0.17
30 0.17
31 0.2
32 0.18
33 0.19
34 0.16
35 0.17
36 0.17
37 0.2
38 0.2
39 0.18
40 0.26
41 0.28
42 0.29
43 0.3
44 0.37
45 0.42
46 0.49
47 0.58
48 0.56
49 0.55
50 0.54
51 0.53
52 0.47
53 0.47
54 0.43
55 0.35
56 0.34
57 0.32
58 0.33
59 0.37
60 0.4
61 0.37
62 0.38
63 0.42
64 0.43
65 0.48
66 0.48
67 0.45
68 0.49
69 0.51
70 0.53
71 0.57
72 0.61
73 0.67
74 0.74
75 0.81
76 0.83
77 0.87
78 0.91
79 0.92
80 0.94
81 0.95
82 0.95
83 0.97
84 0.97
85 0.97
86 0.97
87 0.97
88 0.95