Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MVQ6

Protein Details
Accession A0A4S2MVQ6   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPPPPKGPSQKEKKEKKPFHIKKKDLDLDEBasic
NLS Segment(s)
PositionSequence
5-24PKGPSQKEKKEKKPFHIKKK
Subcellular Location(s) nucl 9, cyto 7.5, cyto_mito 7.5, mito 6.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039159  SAYSD1  
IPR019387  SAYSvFN_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10260  SAYSvFN  
Amino Acid Sequences MPPPPKGPSQKEKKEKKPFHIKKKDLDLDEYRRELADGEPGKLVTKAAGAVLYSRQFWAYVILQIASAWLGYGQAMLCIGILWMCYVNTGKRKKGEKSAYSLFNEGFEAIDGSTNMQMLDRELRRQLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.9
4 0.91
5 0.91
6 0.91
7 0.92
8 0.87
9 0.85
10 0.86
11 0.84
12 0.75
13 0.71
14 0.68
15 0.64
16 0.64
17 0.56
18 0.46
19 0.38
20 0.35
21 0.29
22 0.21
23 0.22
24 0.18
25 0.18
26 0.18
27 0.18
28 0.19
29 0.18
30 0.17
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.11
46 0.09
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.05
54 0.04
55 0.03
56 0.03
57 0.02
58 0.02
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.06
74 0.11
75 0.19
76 0.24
77 0.29
78 0.36
79 0.43
80 0.47
81 0.56
82 0.62
83 0.59
84 0.62
85 0.64
86 0.63
87 0.59
88 0.56
89 0.46
90 0.37
91 0.32
92 0.24
93 0.18
94 0.12
95 0.1
96 0.08
97 0.09
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.1
106 0.19
107 0.2
108 0.25