Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SJ95

Protein Details
Accession A0A4V3SJ95   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
131-163AAKEHERPGLKRKRLKRQRWRARFKEGFKRMVQBasic
NLS Segment(s)
PositionSequence
130-160KAAKEHERPGLKRKRLKRQRWRARFKEGFKR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MAVPRRAAMTLTRRPLLVPSTPSLLRTFTTTPRRLNTQRDKLNAVKNIFSTPQRTPQSSGPRRSPLGSLGALGSQISAAPSMAPVPHIEQKLPKMGPSAGRSIMVTQGLPQAFMKLNYVLRENNVKGMVKAAKEHERPGLKRKRLKRQRWRARFKEGFKRMVQTALKMKKMGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.39
4 0.35
5 0.3
6 0.27
7 0.31
8 0.31
9 0.32
10 0.3
11 0.28
12 0.23
13 0.24
14 0.24
15 0.27
16 0.37
17 0.41
18 0.44
19 0.46
20 0.54
21 0.55
22 0.62
23 0.65
24 0.65
25 0.67
26 0.66
27 0.68
28 0.65
29 0.68
30 0.64
31 0.55
32 0.47
33 0.41
34 0.4
35 0.36
36 0.33
37 0.3
38 0.26
39 0.33
40 0.34
41 0.35
42 0.36
43 0.41
44 0.5
45 0.53
46 0.57
47 0.53
48 0.54
49 0.54
50 0.52
51 0.45
52 0.36
53 0.32
54 0.25
55 0.2
56 0.15
57 0.13
58 0.12
59 0.1
60 0.08
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.07
73 0.12
74 0.12
75 0.13
76 0.15
77 0.17
78 0.22
79 0.22
80 0.2
81 0.18
82 0.19
83 0.23
84 0.23
85 0.25
86 0.19
87 0.2
88 0.2
89 0.18
90 0.18
91 0.13
92 0.11
93 0.09
94 0.12
95 0.12
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.14
102 0.13
103 0.15
104 0.15
105 0.18
106 0.16
107 0.18
108 0.24
109 0.23
110 0.24
111 0.25
112 0.24
113 0.22
114 0.26
115 0.27
116 0.21
117 0.24
118 0.26
119 0.32
120 0.34
121 0.36
122 0.39
123 0.44
124 0.47
125 0.54
126 0.59
127 0.59
128 0.66
129 0.74
130 0.77
131 0.8
132 0.88
133 0.89
134 0.9
135 0.92
136 0.94
137 0.95
138 0.92
139 0.92
140 0.9
141 0.88
142 0.88
143 0.84
144 0.8
145 0.72
146 0.7
147 0.6
148 0.6
149 0.53
150 0.48
151 0.51
152 0.52
153 0.52