Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3SJP5

Protein Details
Accession A0A4V3SJP5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
42-61VFACKKCKKCFRKDVTDWDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQVSIRSPCCKKWFDCAECHAEAADHNLARSTEMVFACKKCKKCFRKDVTDWDESDEFCPHCDNQFVLDAKTPQAALRIEGEDIRVDSKMIKDDRVSEDADRSISRYDDIISSKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.42
4 0.43
5 0.44
6 0.5
7 0.57
8 0.55
9 0.58
10 0.57
11 0.56
12 0.51
13 0.49
14 0.39
15 0.28
16 0.24
17 0.22
18 0.2
19 0.14
20 0.13
21 0.14
22 0.14
23 0.15
24 0.15
25 0.11
26 0.12
27 0.12
28 0.15
29 0.16
30 0.18
31 0.25
32 0.3
33 0.33
34 0.37
35 0.47
36 0.54
37 0.62
38 0.71
39 0.72
40 0.77
41 0.78
42 0.8
43 0.76
44 0.7
45 0.6
46 0.53
47 0.45
48 0.35
49 0.3
50 0.21
51 0.15
52 0.12
53 0.13
54 0.1
55 0.1
56 0.11
57 0.1
58 0.1
59 0.15
60 0.15
61 0.15
62 0.17
63 0.17
64 0.16
65 0.17
66 0.15
67 0.1
68 0.13
69 0.13
70 0.12
71 0.14
72 0.14
73 0.14
74 0.14
75 0.15
76 0.12
77 0.12
78 0.12
79 0.1
80 0.09
81 0.1
82 0.11
83 0.17
84 0.18
85 0.2
86 0.2
87 0.26
88 0.31
89 0.32
90 0.33
91 0.27
92 0.29
93 0.28
94 0.29
95 0.24
96 0.21
97 0.2
98 0.18
99 0.18
100 0.16
101 0.16
102 0.18
103 0.2