Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2MJM2

Protein Details
Accession A0A4S2MJM2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
77-127SNNSEQKKKAYQKTRTHNPIKPAKKHPRKKKTPPKNKQRQYSVSKSQKPKTHydrophilic
NLS Segment(s)
PositionSequence
83-117KKKAYQKTRTHNPIKPAKKHPRKKKTPPKNKQRQY
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MSTSPINTSTLLHPSIPHIILHPTNPKTTVCIYPKYIQPALRKVPTRKWTRTRTEKDSNQHSQKQQYQSLTTEKQPSNNSEQKKKAYQKTRTHNPIKPAKKHPRKKKTPPKNKQRQYSVSKSQKPKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.24
4 0.21
5 0.18
6 0.22
7 0.23
8 0.27
9 0.32
10 0.3
11 0.31
12 0.32
13 0.31
14 0.29
15 0.31
16 0.35
17 0.3
18 0.33
19 0.35
20 0.38
21 0.41
22 0.44
23 0.44
24 0.41
25 0.43
26 0.46
27 0.47
28 0.5
29 0.53
30 0.51
31 0.57
32 0.6
33 0.63
34 0.65
35 0.68
36 0.7
37 0.73
38 0.79
39 0.77
40 0.77
41 0.78
42 0.76
43 0.73
44 0.73
45 0.71
46 0.67
47 0.65
48 0.6
49 0.57
50 0.56
51 0.54
52 0.5
53 0.43
54 0.38
55 0.35
56 0.38
57 0.33
58 0.31
59 0.33
60 0.3
61 0.33
62 0.33
63 0.34
64 0.37
65 0.41
66 0.44
67 0.45
68 0.49
69 0.5
70 0.57
71 0.62
72 0.63
73 0.67
74 0.71
75 0.73
76 0.78
77 0.83
78 0.84
79 0.84
80 0.79
81 0.78
82 0.78
83 0.78
84 0.76
85 0.76
86 0.78
87 0.8
88 0.86
89 0.89
90 0.9
91 0.91
92 0.94
93 0.95
94 0.95
95 0.96
96 0.96
97 0.96
98 0.96
99 0.95
100 0.94
101 0.92
102 0.91
103 0.88
104 0.87
105 0.86
106 0.86
107 0.86