Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N2V8

Protein Details
Accession A0A4S2N2V8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-85NGTKQRPTNIRRTRQKRRQKLAEVDAHydrophilic
NLS Segment(s)
PositionSequence
70-80RRTRQKRRQKL
93-111RRRVEEAVRTLKKSGKIKS
Subcellular Location(s) mito 17, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MRHTAHILSFLILSPEDLTMKVSQTTTTTNFTFHNHSSTMTVATTSTLSAASQSLAHLLNGTKQRPTNIRRTRQKRRQKLAEVDAARSAEEERRRVEEAVRTLKKSGKIKSKELEVREQVSWPATLGRHGARHRTKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.12
6 0.11
7 0.13
8 0.14
9 0.13
10 0.13
11 0.14
12 0.18
13 0.19
14 0.22
15 0.21
16 0.21
17 0.22
18 0.24
19 0.27
20 0.25
21 0.25
22 0.21
23 0.22
24 0.21
25 0.21
26 0.19
27 0.14
28 0.13
29 0.1
30 0.1
31 0.09
32 0.07
33 0.07
34 0.06
35 0.05
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.12
47 0.16
48 0.17
49 0.17
50 0.18
51 0.21
52 0.27
53 0.31
54 0.37
55 0.42
56 0.51
57 0.59
58 0.68
59 0.77
60 0.8
61 0.87
62 0.87
63 0.88
64 0.87
65 0.85
66 0.84
67 0.78
68 0.76
69 0.67
70 0.57
71 0.49
72 0.4
73 0.31
74 0.24
75 0.19
76 0.16
77 0.18
78 0.2
79 0.2
80 0.23
81 0.25
82 0.26
83 0.28
84 0.29
85 0.32
86 0.4
87 0.42
88 0.4
89 0.4
90 0.44
91 0.48
92 0.49
93 0.5
94 0.5
95 0.52
96 0.58
97 0.61
98 0.66
99 0.66
100 0.64
101 0.65
102 0.59
103 0.58
104 0.51
105 0.47
106 0.39
107 0.33
108 0.29
109 0.2
110 0.19
111 0.15
112 0.16
113 0.19
114 0.22
115 0.28
116 0.32
117 0.42