Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S2N372

Protein Details
Accession A0A4S2N372    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-85ASRTTRPGKARQRDRYGKREEBasic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MGALPSATAAAAVTHRRSSTAIGAAAGVRVWVGDGGGCGGCGVESSQTGGENGHDDDGGWWWVVASRTTRPGKARQRDRYGKREEASNYKSGVDNKASARGGSQKPGTMEQEKKKGPPVAWDDGGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.22
5 0.24
6 0.24
7 0.24
8 0.22
9 0.19
10 0.2
11 0.18
12 0.17
13 0.14
14 0.09
15 0.05
16 0.04
17 0.04
18 0.03
19 0.03
20 0.03
21 0.03
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.04
31 0.04
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.05
49 0.07
50 0.07
51 0.08
52 0.09
53 0.1
54 0.18
55 0.19
56 0.23
57 0.24
58 0.34
59 0.43
60 0.5
61 0.59
62 0.61
63 0.7
64 0.77
65 0.81
66 0.81
67 0.78
68 0.75
69 0.66
70 0.63
71 0.56
72 0.55
73 0.52
74 0.46
75 0.4
76 0.34
77 0.36
78 0.32
79 0.32
80 0.26
81 0.25
82 0.24
83 0.29
84 0.29
85 0.26
86 0.26
87 0.3
88 0.3
89 0.32
90 0.33
91 0.29
92 0.31
93 0.36
94 0.39
95 0.38
96 0.45
97 0.47
98 0.55
99 0.55
100 0.55
101 0.59
102 0.59
103 0.53
104 0.53
105 0.53
106 0.51
107 0.5