Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DCT6

Protein Details
Accession A5DCT6   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
97-116GTGIRRRIWVRRRRRGSAADBasic
NLS Segment(s)
PositionSequence
101-111RRRIWVRRRRR
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
KEGG pgu:PGUG_01091  -  
Amino Acid Sequences MATACDYIVEYQRGFKFFGIPLYSQRSLIPFADPSEFETLGGRKLLLSYGSIQNYPLPDLDWNWDWERWYVLMTDSVDDQGWMYAGWSGWSSKYRLGTGIRRRIWVRRRRRGSAADSTSTASLLADAGQTNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.25
4 0.24
5 0.3
6 0.26
7 0.25
8 0.28
9 0.35
10 0.35
11 0.32
12 0.31
13 0.27
14 0.26
15 0.25
16 0.23
17 0.16
18 0.17
19 0.19
20 0.18
21 0.19
22 0.2
23 0.19
24 0.17
25 0.18
26 0.17
27 0.16
28 0.16
29 0.13
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.1
36 0.14
37 0.15
38 0.15
39 0.16
40 0.16
41 0.16
42 0.16
43 0.13
44 0.09
45 0.08
46 0.09
47 0.12
48 0.11
49 0.13
50 0.14
51 0.14
52 0.15
53 0.14
54 0.14
55 0.11
56 0.11
57 0.09
58 0.08
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.06
76 0.08
77 0.1
78 0.12
79 0.14
80 0.17
81 0.17
82 0.2
83 0.25
84 0.33
85 0.41
86 0.49
87 0.49
88 0.51
89 0.54
90 0.6
91 0.64
92 0.65
93 0.66
94 0.67
95 0.74
96 0.76
97 0.8
98 0.79
99 0.76
100 0.77
101 0.72
102 0.64
103 0.57
104 0.52
105 0.44
106 0.36
107 0.29
108 0.18
109 0.12
110 0.09
111 0.07
112 0.07